Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-GSTA3 Antibody Titration: 0.2-1 ug/mlPositive Control: HCT15 cell lysate)

Rabbit GSTA3 Polyclonal Antibody | anti-GSTA3 antibody

GSTA3 antibody - middle region

Gene Names
GSTA3; GTA3; GSTA3-3
Reactivity
Human, Mouse, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GSTA3; Polyclonal Antibody; GSTA3 antibody - middle region; anti-GSTA3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFR
Sequence Length
222
Applicable Applications for anti-GSTA3 antibody
Western Blot (WB)
Homology
Human: 100%; Mouse: 79%; Sheep: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GSTA3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-GSTA3 Antibody Titration: 0.2-1 ug/mlPositive Control: HCT15 cell lysate)

Western Blot (WB) (WB Suggested Anti-GSTA3 Antibody Titration: 0.2-1 ug/mlPositive Control: HCT15 cell lysate)
Related Product Information for anti-GSTA3 antibody
This is a rabbit polyclonal antibody against GSTA3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class genes that are located in a cluster mapped to chromosome 6. Genes of the alpha class are highly related and encode enzymes with glutathione peroxidase activity. However, during evolution, this alpha class gene diverged accumulating mutations in the active site that resulted in differences in substrate specificity and catalytic activity. The enzyme encoded by this gene catalyzes the double bond isomerization of precursors for progesterone and testosterone during the biosynthesis of steroid hormones. An additional transcript variant has been identified, but its full length sequence has not been determined.
Product Categories/Family for anti-GSTA3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25kDa
NCBI Official Full Name
glutathione S-transferase A3 isoform 1
NCBI Official Synonym Full Names
glutathione S-transferase alpha 3
NCBI Official Symbol
GSTA3
NCBI Official Synonym Symbols
GTA3; GSTA3-3
NCBI Protein Information
glutathione S-transferase A3
UniProt Protein Name
Glutathione S-transferase A3
Protein Family
UniProt Gene Name
GSTA3
UniProt Entry Name
GSTA3_HUMAN

NCBI Description

Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class genes that are located in a cluster mapped to chromosome 6. Genes of the alpha class are highly related and encode enzymes with glutathione peroxidase activity. However, during evolution, this alpha class gene diverged accumulating mutations in the active site that resulted in differences in substrate specificity and catalytic activity. The enzyme encoded by this gene catalyzes the double bond isomerization of precursors for progesterone and testosterone during the biosynthesis of steroid hormones. An additional transcript variant has been identified, but its full length sequence has not been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

GSTA3: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Catalyzes isomerization reactions that contribute to the biosynthesis of steroid hormones. Efficiently catalyze obligatory double-bond isomerizations of delta(5)-androstene-3,17-dione and delta(5)- pregnene-3,20-dione, precursors to testosterone and progesterone, respectively. Belongs to the GST superfamily. Alpha family.

Protein type: Xenobiotic Metabolism - metabolism by cytochrome P450; Other Amino Acids Metabolism - glutathione; Xenobiotic Metabolism - drug metabolism - cytochrome P450; EC 2.5.1.18; Transferase

Chromosomal Location of Human Ortholog: 6p12.1

Cellular Component: cytosol

Molecular Function: glutathione transferase activity

Biological Process: glutathione metabolic process; xenobiotic metabolic process

Research Articles on GSTA3

Similar Products

Product Notes

The GSTA3 gsta3 (Catalog #AAA3209036) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GSTA3 antibody - middle region reacts with Human, Mouse, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's GSTA3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GSTA3 gsta3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SSLISNFPLL KALKTRISNL PTVKKFLQPG SPRKPPADAK ALEEARKIFR. It is sometimes possible for the material contained within the vial of "GSTA3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.