Rabbit UMPS Polyclonal Antibody | anti-UMPS antibody

UMPS antibody - C-terminal region

Cat. Num. AAA3208877

• Gene Names: UMPS; OPRT
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast
• Applications: Immunohistochemistry, Western Blot
• Purity: Affinity Purified
• Synonyms: UMPS; Polyclonal Antibody; UMPS antibody - C-terminal region; anti-UMPS antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: VGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDII
• Sequence Length: 480

• Applicable Applications for anti-UMPS antibody: Immunohistochemistry (IHC), Western Blot (WB)
• Homology: Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 93%; Yeast: 75%
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human UMPS
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-UMPS AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Other Working Concentrations: 1/600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(Host: RabbitTarget Name: UMPSSample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: UMPSSample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-UMPS Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysateUMPS is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Related Product Information for anti-UMPS antibody

This is a rabbit polyclonal antibody against UMPS. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: OPRT (UMPS) is involved in early events of pancreatic and gallbladder carcinogenesis and invasion of hepatocellular carcinomas. Orotate phosphoribosyltransferase is involved in the invasion and metastasis of colorectal carcinoma. Determination of OPRT levels in gastric carcinoma tissue enables to predict the response to S-1-based neoadjuvant/adjuvant chemotherapy.

Product Categories/Family for anti-UMPS antibody

Polyclonal; Drugs and Drug Metabolism; Disease Related

NCBI and Uniprot Product Information

• NCBI GI #: 4507835
• NCBI GeneID: 7372
• NCBI Accession #: NP_000364
• NCBI GenBank Nucleotide #: NM_000373
• UniProt Accession #: P11172
• Molecular Weight: 52kDa
• NCBI Official Full Name: uridine 5'-monophosphate synthase
• NCBI Official Synonym Full Names: uridine monophosphate synthetase
• NCBI Official Symbol: UMPS
• NCBI Official Synonym Symbols: OPRT
• NCBI Protein Information: uridine 5'-monophosphate synthase
• UniProt Protein Name: Uridine 5'-monophosphate synthase
• Protein Family: Uridine 5'-monophosphate synthase
• UniProt Gene Name: UMPS
• UniProt Synonym Gene Names: UMP synthase; OPRT; OPRTase; ODC
• UniProt Entry Name: UMPS_HUMAN

NCBI Description

This gene encodes a uridine 5'-monophosphate synthase. The encoded protein is a bifunctional enzyme that catalyzes the final two steps of the de novo pyrimidine biosynthetic pathway. The first reaction is carried out by the N-terminal enzyme orotate phosphoribosyltransferase which converts orotic acid to orotidine-5'-monophosphate. The terminal reaction is carried out by the C-terminal enzyme OMP decarboxylase which converts orotidine-5'-monophosphate to uridine monophosphate. Defects in this gene are the cause of hereditary orotic aciduria. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010]

Uniprot Description

UMPS: Defects in UMPS are the cause of orotic aciduria type 1 (ORAC1). A disorder of pyrimidine metabolism resulting in megaloblastic anemia and orotic acid crystalluria that is frequently associated with some degree of physical and mental retardation. A minority of cases have additional features, particularly congenital malformations and immune deficiencies. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 4.1.1.23; Transferase; Xenobiotic Metabolism - drug metabolism - other enzymes; Nucleotide Metabolism - pyrimidine; EC 2.4.2.10; Lyase

Chromosomal Location of Human Ortholog: 3q13

Cellular Component: cytoplasm; cytosol; nucleus

Molecular Function: orotate phosphoribosyltransferase activity; orotidine-5'-phosphate decarboxylase activity

Biological Process: lactation; 'de novo' pyrimidine base biosynthetic process; pyrimidine base metabolic process; nucleobase, nucleoside and nucleotide metabolic process; UMP biosynthetic process; pyrimidine nucleoside biosynthetic process; female pregnancy

Disease: Orotic Aciduria