Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-ME1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit ME1 Polyclonal Antibody | anti-ME1 antibody

ME1 antibody - N-terminal region

Gene Names
ME1; MES; HUMNDME
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
ME1; Polyclonal Antibody; ME1 antibody - N-terminal region; anti-ME1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QQLNIHGLLPPSFNSQEIQVLRVVKNFEHLNSDFDRYLLLMDLQDRNEKL
Sequence Length
572
Applicable Applications for anti-ME1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 92%; Dog: 85%; Horse: 92%; Human: 100%; Mouse: 100%; Pig: 91%; Rabbit: 100%; Rat: 100%; Sheep: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ME1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-ME1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-ME1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(Host: RabbitTarget Name: ME1Sample Type: 293TAntibody Dilution: 1.0ug/mlME1 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)

Western Blot (WB) (Host: RabbitTarget Name: ME1Sample Type: 293TAntibody Dilution: 1.0ug/mlME1 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)

Western Blot (WB)

(WB Suggested Anti-ME1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-ME1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)
Related Product Information for anti-ME1 antibody
This is a rabbit polyclonal antibody against ME1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ME1 is a cytosolic, NADP-dependent enzyme that generates NADPH for fatty acid biosynthesis. The activity of this enzyme, the reversible oxidative decarboxylation of malate, links the glycolytic and citric acid cycles. The regulation of expression for this gene is complex. Increased expression can result from elevated levels of thyroid hormones or by higher proportions of carbohydrates in the diet.This gene encodes a cytosolic, NADP-dependent enzyme that generates NADPH for fatty acid biosynthesis. The activity of this enzyme, the reversible oxidative decarboxylation of malate, links the glycolytic and citric acid cycles. The regulation of expression for this gene is complex. Increased expression can result from elevated levels of thyroid hormones or by higher proportions of carbohydrates in the diet. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-ME1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64kDa
NCBI Official Full Name
NADP-dependent malic enzyme
NCBI Official Synonym Full Names
malic enzyme 1
NCBI Official Symbol
ME1
NCBI Official Synonym Symbols
MES; HUMNDME
NCBI Protein Information
NADP-dependent malic enzyme
UniProt Protein Name
NADP-dependent malic enzyme
UniProt Gene Name
ME1
UniProt Synonym Gene Names
NADP-ME
UniProt Entry Name
MAOX_HUMAN

NCBI Description

This gene encodes a cytosolic, NADP-dependent enzyme that generates NADPH for fatty acid biosynthesis. The activity of this enzyme, the reversible oxidative decarboxylation of malate, links the glycolytic and citric acid cycles. The regulation of expression for this gene is complex. Increased expression can result from elevated levels of thyroid hormones or by higher proportions of carbohydrates in the diet. [provided by RefSeq, Jul 2008]

Uniprot Description

ME1: a ubiquitous lipogenic enzyme of the malic enzymes family. Converts (S)-malate + NADP+ ?? pyruvate + CO2 + NADPH. Levels of ME1 and ATP-citrate lyase mRNA, another lipogenic enzyme, are coordinately increased 5-7 fold during the differentiation of 3T3-L1 preadipocytes into adipocytes. Up-regulated by short-term dietary restriction in mice. The cycling of pyruvate by ME1 generates cytosolic NADPH, whereas mitochondrial ME2 responds to elevated amino acids and serves to supply sufficient pyruvate for increased Krebs cycle flux when glucose is limiting.

Protein type: Carbohydrate Metabolism - pyruvate; EC 1.1.1.40; Oxidoreductase

Chromosomal Location of Human Ortholog: 6q12

Cellular Component: mitochondrion; cytosol

Molecular Function: malate dehydrogenase (decarboxylating) activity; malic enzyme activity; electron carrier activity; manganese ion binding; malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+) activity; NADP binding; ADP binding; NAD binding; oxaloacetate decarboxylase activity

Biological Process: malate metabolic process; carbohydrate metabolic process; response to hormone stimulus; cellular lipid metabolic process; NADP biosynthetic process; protein tetramerization; response to carbohydrate stimulus

Research Articles on ME1

Similar Products

Product Notes

The ME1 me1 (Catalog #AAA3201171) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ME1 antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's ME1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the ME1 me1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QQLNIHGLLP PSFNSQEIQV LRVVKNFEHL NSDFDRYLLL MDLQDRNEKL. It is sometimes possible for the material contained within the vial of "ME1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.