Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-LZTR1 Antibody Titration: 2.5ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

Rabbit LZTR1 Polyclonal Antibody | anti-LZTR1 antibody

LZTR1 antibody - C-terminal region

Gene Names
LZTR1; NS2; NS10; BTBD29; LZTR-1; SWNTS2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
LZTR1; Polyclonal Antibody; LZTR1 antibody - C-terminal region; anti-LZTR1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GFYNNRLQAYCKQNLEMNVTVQNVLQILEAADKTQALDMKRHCLHIIVHQ
Sequence Length
840
Applicable Applications for anti-LZTR1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human LZTR1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-LZTR1 Antibody Titration: 2.5ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-LZTR1 Antibody Titration: 2.5ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)
Related Product Information for anti-LZTR1 antibody
This is a rabbit polyclonal antibody against LZTR1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Leucine-zipper-like transcriptional regulator 1(LZTR1) is belived to be a DNA-binding protein and transcriptional regulator based on its predicted structural characteristics. The transcript is present in several essential fetal organs and is hemizygously deleted in some DiGeorge syndrome patients. LZTR1 is thought to play a critical role in embryogenesis.Leucine-zipper-like transcriptional regulator 1 is belived to be a DNA-binding protein and transcriptional regulator based on its predicted structural characteristics. The transcript is present in several essential fetal organs and is hemizygously deleted in some DiGeorge syndrome patients. It is thought to play a critical role in embryogenesis.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
95kDa
NCBI Official Full Name
leucine-zipper-like transcriptional regulator 1
NCBI Official Synonym Full Names
leucine zipper like transcription regulator 1
NCBI Official Symbol
LZTR1
NCBI Official Synonym Symbols
NS2; NS10; BTBD29; LZTR-1; SWNTS2
NCBI Protein Information
leucine-zipper-like transcriptional regulator 1
UniProt Protein Name
Leucine-zipper-like transcriptional regulator 1
UniProt Gene Name
LZTR1
UniProt Synonym Gene Names
TCFL2; LZTR-1
UniProt Entry Name
LZTR1_HUMAN

NCBI Description

This gene encodes a member of the BTB-kelch superfamily. Initially described as a putative transcriptional regulator based on weak homology to members of the basic leucine zipper-like family, the encoded protein subsequently has been shown to localize exclusively to the Golgi network where it may help stabilize the Gogli complex. Deletion of this gene may be associated with DiGeorge syndrome. [provided by RefSeq, Jul 2008]

Uniprot Description

LZTR1: Probable transcriptional regulator that may play a crucial role in embryogenesis.

Protein type: EC 3.4.22.-; Transcription factor

Chromosomal Location of Human Ortholog: 22q11.21|22q11.1-q11.2

Molecular Function: transcription factor activity

Biological Process: anatomical structure morphogenesis; regulation of transcription, DNA-dependent

Disease: Schwannomatosis 2

Research Articles on LZTR1

Similar Products

Product Notes

The LZTR1 lztr1 (Catalog #AAA3204312) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LZTR1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's LZTR1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LZTR1 lztr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GFYNNRLQAY CKQNLEMNVT VQNVLQILEA ADKTQALDMK RHCLHIIVHQ. It is sometimes possible for the material contained within the vial of "LZTR1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.