Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ZNF41 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

Rabbit ZNF41 Polyclonal Antibody | anti-ZNF41 antibody

ZNF41 antibody - C-terminal region

Gene Names
ZNF41; MRX89
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ZNF41; Polyclonal Antibody; ZNF41 antibody - C-terminal region; anti-ZNF41 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LRVHQKIHTGEKPNICAECGKAFTDRSNLITHQKIHTREKPYECGDCGKT
Sequence Length
779
Applicable Applications for anti-ZNF41 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF41
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ZNF41 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-ZNF41 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)
Related Product Information for anti-ZNF41 antibody
This is a rabbit polyclonal antibody against ZNF41. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ZNF41 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 18 C2H2-type zinc fingers and 1 KRAB domain. ZNF41 may be involved in transcriptional regulation. A chromosomal aberration, translocation t(X;7)(p11.3;q11.21), involving ZNF41 has been found in a patient with sever mental retardation. This gene product is a likely zinc finger family transcription factor. It contains KRAB-A and KRAB-B domains that act as transcriptional repressors in related proteins, and multiple zinc finger DNA binding motifs and finger linking regions characteristic of the Kruppel family. This gene is part of a gene cluster on chromosome Xp11.23. Several alternatively spliced transcript variants have been described, however, the full-length nature of only some of them is known.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
89kDa
NCBI Official Full Name
zinc finger protein 41 isoform a
NCBI Official Synonym Full Names
zinc finger protein 41
NCBI Official Symbol
ZNF41
NCBI Official Synonym Symbols
MRX89
NCBI Protein Information
zinc finger protein 41
Protein Family

NCBI Description

This gene encodes a protein that contains KRAB-A and KRAB-B domains multiple zinc finger DNA binding motifs and finger linking regions characteristic of the Kruppel family. An initial study suggested that this gene may be associated with X-linked cognitive disability, but a later study has called this finding into question (PMID:23871722).[provided by RefSeq, Apr 2016]

Research Articles on ZNF41

Similar Products

Product Notes

The ZNF41 (Catalog #AAA3208739) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZNF41 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF41 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZNF41 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LRVHQKIHTG EKPNICAECG KAFTDRSNLI THQKIHTREK PYECGDCGKT. It is sometimes possible for the material contained within the vial of "ZNF41, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.