Mouse anti-Human COX5B Polyclonal Antibody | anti-COX5B antibody

COX5B (Cytochrome C Oxidase Subunit 5B, Cytochrome C Oxidase Polypeptide VB Mitochondrial, Cytochrome C Oxidase Subunit Vb, COXVB)

Cat. Num. AAA646883

• Gene Names: COX5B; COXVB
• Reactivity: Human
• Applications: Western Blot, Immunofluorescence
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: COX5B; Polyclonal Antibody; COX5B (Cytochrome C Oxidase Subunit 5B; Cytochrome C Oxidase Polypeptide VB Mitochondrial; Cytochrome C Oxidase Subunit Vb; COXVB); Anti -COX5B (Cytochrome C Oxidase Subunit 5B; anti-COX5B antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human COX5B.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MASRLLRGAGTLAAQALRARGPSGAAAMRSMASGGGVPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVPQQLAH

• Applicable Applications for anti-COX5B antibody: Western Blot (WB), Immunofluorescence (IF)
• Application Notes: Suitable for use in Immunofluorescence and Western Blot.; Dilution: Immunofluorescence: 10ug/ml
• Immunogen: Full length human COX5B, aa1-129 (NP_001853.2).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(COX5B polyclonal antibody. Western Blot analysis of COX5B expression in human pancreas.)

Western Blot (WB)

(COX5B polyclonal antibody. Western Blot analysis of COX5B expression in HepG2.)

Western Blot (WB)

(Western Blot analysis of COX5B expression in transfected 293T cell line by COX5B polyclonal antibody. Lane1:COX5B transfected lysate (14.19kD). Lane2:Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified antibody to COX5B on HeLa cell. [antibody concentration 10ug/ml].)

Related Product Information for anti-COX5B antibody

Cytochrome C oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer and proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. This gene encodes the nuclear-encoded subunit Vb of the human mitochondrial respiratory chain enzyme.

Product Categories/Family for anti-COX5B antibody

Antibodies; Abs to Cytochrome

NCBI and Uniprot Product Information

• NCBI GI #: 17017988
• NCBI GeneID: 1329
• NCBI Accession #: NP_001853.2
• NCBI GenBank Nucleotide #: NM_001862.2
• UniProt Accession #: P10606; Q53YB7; Q96J18; Q99610
• Molecular Weight: 13,696 Da
• NCBI Official Full Name: cytochrome c oxidase subunit 5B, mitochondrial
• NCBI Official Synonym Full Names: cytochrome c oxidase subunit Vb
• NCBI Official Symbol: COX5B
• NCBI Official Synonym Symbols: COXVB
• NCBI Protein Information: cytochrome c oxidase subunit 5B, mitochondrial; cytochrome c oxidase polypeptide VB, mitochondrial
• UniProt Protein Name: Cytochrome c oxidase subunit 5B, mitochondrial
• Protein Family: Cytochrome c oxidase polypeptide
• UniProt Gene Name: COX5B
• UniProt Entry Name: COX5B_HUMAN

NCBI Description

Cytochrome C oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer and proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. This gene encodes the nuclear-encoded subunit Vb of the human mitochondrial respiratory chain enzyme. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.

Subcellular location: Mitochondrion inner membrane.

Sequence similarities: Belongs to the cytochrome c oxidase subunit 5B family.