SDS-PAGE
BTB/POZ domain-containing protein KCTD15 (KCTD15) Recombinant Protein | KCTD15 recombinant protein
Recombinant Human BTB/POZ domain-containing protein KCTD15 (KCTD15)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
BTB/POZ domain-containing protein KCTD15 (KCTD15); Recombinant Human BTB/POZ domain-containing protein KCTD15 (KCTD15); BTB/POZ domain-containing protein KCTD15; KCTD15 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-234aa; Full Length of Isoform 2
Sequence
MPHRKERPSGSSLHTHGSTGTAEGGNMSRLSLTRSPVSPLAAQGIPLPAQLTKSNAPVHIDVGGHMYTSSLATLTKYPDSRISRLFNGTEPIVLDSLKQHYFIDRDGEIFRYVLSFLRTSKLLLPDDFKDFSLLYEEARYYQLQPMVRELERWQQEQEQRRRSRACDCLVVRVTPDLGERIALSGEKALIEEVFPETGDVMCNSVNAGWNQDPTHVIRFPLNGYCRLNSVQDVL
Sequence Length
283
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-PAGE
SDS-PAGE
Related Product Information for KCTD15 recombinant protein
During embryonic development, interferes with neural crest formation. Inhibits AP2 transcriptional activity by interaction with its activation domain.
Product Categories/Family for KCTD15 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
53.5 kDa
NCBI Official Full Name
BTB/POZ domain-containing protein KCTD15 isoform 2
NCBI Official Synonym Full Names
potassium channel tetramerization domain containing 15
NCBI Official Symbol
KCTD15
NCBI Protein Information
BTB/POZ domain-containing protein KCTD15; potassium channel tetramerisation domain containing 15; potassium channel tetramerization domain-containing protein 15
UniProt Protein Name
BTB/POZ domain-containing protein KCTD15
Protein Family
UniProt Gene Name
KCTD15
UniProt Entry Name
KCD15_HUMAN
Uniprot Description
KCTD15: 2 isoforms of the human protein are produced by alternative splicing.
Chromosomal Location of Human Ortholog: 19q13.11
Biological Process: multicellular organismal development; protein homooligomerization
Research Articles on KCTD15
Similar Products
Product Notes
The KCTD15 kctd15 (Catalog #AAA1398953) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-234aa; Full Length of Isoform 2. The amino acid sequence is listed below: MPHRKERPSG SSLHTHGSTG TAEGGNMSRL SLTRSPVSPL AAQGIPLPAQ LTKSNAPVHI DVGGHMYTSS LATLTKYPDS RISRLFNGTE PIVLDSLKQH YFIDRDGEIF RYVLSFLRTS KLLLPDDFKD FSLLYEEARY YQLQPMVREL ERWQQEQEQR RRSRACDCLV VRVTPDLGER IALSGEKALI EEVFPETGDV MCNSVNAGWN QDPTHVIRFP LNGYCRLNSV QDVL. It is sometimes possible for the material contained within the vial of "BTB/POZ domain-containing protein KCTD15 (KCTD15), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
