Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Mouse anti-Human, Mouse PAX7 Monoclonal Antibody | anti-PAX7 antibody

PAX7 (Paired Box Protein Pax-7, HuP1, HUP1) (PE)

Gene Names
PAX7; HUP1; RMS2; PAX7B
Reactivity
Human, Mouse
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PAX7; Monoclonal Antibody; PAX7 (Paired Box Protein Pax-7; HuP1; HUP1) (PE); anti-PAX7 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1E12
Specificity
Recognizes human PAX7. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-PAX7 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 0.5ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa411-521 from human PAX7 (NP_002575) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GGLDSATSISASCSQRADSIKPGDSLPTSQAYCPPTYSTTGYSVDPVAGYQYGQYGQSECLVPWASPVPIPSPTPRASCLFMESYKVVSGWGMSISQMEKLKSSQMEQFT
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB)

(PAX7 monoclonal antibody Western Blot analysis of PAX7 expression in NIH/3T3.)

Western Blot (WB) (PAX7 monoclonal antibody Western Blot analysis of PAX7 expression in NIH/3T3.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to PAX7 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 0.5ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to PAX7 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 0.5ug/ml])

Testing Data

(Detection limit for recombinant GST tagged PAX7 is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PAX7 is ~3ng/ml as a capture antibody.)
Product Categories/Family for anti-PAX7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55,119 Da
NCBI Official Full Name
paired box protein Pax-7 isoform 1
NCBI Official Synonym Full Names
paired box 7
NCBI Official Symbol
PAX7
NCBI Official Synonym Symbols
HUP1; RMS2; PAX7B
NCBI Protein Information
paired box protein Pax-7; PAX7 transcriptional factor; paired box homeotic gene 7; paired domain gene 7
UniProt Protein Name
Paired box protein Pax-7
Protein Family
UniProt Gene Name
PAX7
UniProt Synonym Gene Names
HUP1

Uniprot Description

Transcription factor playing a role in myogenesis through regulation of muscle precursor cells proliferation.

Similar Products

Product Notes

The PAX7 pax7 (Catalog #AAA6159292) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PAX7 (Paired Box Protein Pax-7, HuP1, HUP1) (PE) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's PAX7 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 0.5ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PAX7 pax7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PAX7, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.