Western Blot (WB)
(Host: RabbitTarget Name: KCTD15Sample Type: HT1080 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit anti-Human KCTD15 Polyclonal Antibody | anti-KCTD15 antibody
KCTD15 Antibody - N-terminal region
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
KCTD15; Polyclonal Antibody; KCTD15 Antibody - N-terminal region; anti-KCTD15 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SGSSLHTHGSTGTAEGGNMSRLSLTRSPVSPLAAQGIPLPAQLTKSNAPV
Sequence Length
283
Applicable Applications for anti-KCTD15 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human KCTD15
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: KCTD15Sample Type: HT1080 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: KCTD15Sample Type: HT1080 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-KCTD15 antibody
This is a rabbit polyclonal antibody against KCTD15. It was validated on Western Blot
Target Description: During embryonic development, KCTD15 interferes with neural crest formation. It inhibits AP2 transcriptional activity by interaction with its activation domain.
Target Description: During embryonic development, KCTD15 interferes with neural crest formation. It inhibits AP2 transcriptional activity by interaction with its activation domain.
Product Categories/Family for anti-KCTD15 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31kDa
NCBI Official Full Name
BTB/POZ domain-containing protein KCTD15 isoform 2
NCBI Official Synonym Full Names
potassium channel tetramerization domain containing 15
NCBI Official Symbol
KCTD15
NCBI Protein Information
BTB/POZ domain-containing protein KCTD15
UniProt Protein Name
BTB/POZ domain-containing protein KCTD15
Protein Family
UniProt Gene Name
KCTD15
UniProt Entry Name
KCD15_HUMAN
Uniprot Description
KCTD15: 2 isoforms of the human protein are produced by alternative splicing.
Chromosomal Location of Human Ortholog: 19q13.11
Biological Process: multicellular organismal development; protein homooligomerization
Research Articles on KCTD15
Similar Products
Product Notes
The KCTD15 kctd15 (Catalog #AAA3219153) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KCTD15 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KCTD15 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KCTD15 kctd15 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SGSSLHTHGS TGTAEGGNMS RLSLTRSPVS PLAAQGIPLP AQLTKSNAPV. It is sometimes possible for the material contained within the vial of "KCTD15, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
