Protein transport protein yip1 (yip1) Recombinant Protein | SPCC61.04c recombinant protein
Recombinant Schizosaccharomyces pombe Protein transport protein yip1 (yip1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein transport protein yip1 (yip1); Recombinant Schizosaccharomyces pombe Protein transport protein yip1 (yip1); Recombinant Protein transport protein yip1 (yip1); Protein transport protein yip1; SPCC61.04c recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-227
Sequence
MAYYNNPANLQYYDYSYTADNSFNTQSRAAGFYDEPLHEPLSQGWLAAFSTSGYPGEPSLLEELEINFGHIKQKTTHVLNPFKHVDVHIMDDTDMAGPILFCLLFSTFLSLHGRSHFGYIYGIALLGSLSLHFVLRLMSAKNLFFTRTVSVLGYSLLPLVVIAFFKNIFTFNGIAGYALAALACIWCTYAASAMFVGILQVNNMRFLVAYPIALFYGVFAVITVFSK
Sequence Length
227
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25,390 Da
NCBI Official Full Name
Rab GTPase binding (predicted)
NCBI Official Symbol
SPCC61.04c
NCBI Protein Information
Rab GTPase binding (predicted)
UniProt Protein Name
Protein transport protein yip1
UniProt Gene Name
yip1
UniProt Entry Name
YIP1_SCHPO
Uniprot Description
Function: Required for fusion of ER-derived vesicles with the Golgi during ER-to-Golgi protein transport, probably by mediating correct membrane localization of ypt1
By similarity.
Subunit structure: Component of the YIP1-YIF1 complex, composed of at least yif1, yip1 and yos1. The complex interacts with the ER to Golgi SNAREs bos1 and sec22. Interacts with the prenylated form of the Rab GTPases ypt1 and ypt3
By similarity.
Subcellular location: Endoplasmic reticulum membrane; Multi-pass membrane protein
By similarity. Golgi apparatus membrane; Multi-pass membrane protein
By similarity.
Sequence similarities: Belongs to the YIP1 family.
Similar Products
Product Notes
The SPCC61.04c yip1 (Catalog #AAA1127706) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-227. The amino acid sequence is listed below: MAYYNNPANL QYYDYSYTAD NSFNTQSRAA GFYDEPLHEP LSQGWLAAFS TSGYPGEPSL LEELEINFGH IKQKTTHVLN PFKHVDVHIM DDTDMAGPIL FCLLFSTFLS LHGRSHFGYI YGIALLGSLS LHFVLRLMSA KNLFFTRTVS VLGYSLLPLV VIAFFKNIFT FNGIAGYALA ALACIWCTYA ASAMFVGILQ VNNMRFLVAY PIALFYGVFA VITVFSK. It is sometimes possible for the material contained within the vial of "Protein transport protein yip1 (yip1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
