Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: EDNRBSample Tissue: Human Mesenchymoma Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human EDNRB Polyclonal Antibody | anti-EDNRB antibody

EDNRB Antibody - C-terminal region

Gene Names
EDNRB; ETB; ET-B; ETB1; ETBR; ETRB; HSCR; WS4A; ABCDS; ET-BR; HSCR2
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
EDNRB; Polyclonal Antibody; EDNRB Antibody - C-terminal region; anti-EDNRB antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KRFKNCFKSCLCCWCQSFEEKQSLEEKQSCLKFKANDHGYDNFRSSNKYS
Sequence Length
532
Applicable Applications for anti-EDNRB antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human EDNRB
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: EDNRBSample Tissue: Human Mesenchymoma Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: EDNRBSample Tissue: Human Mesenchymoma Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-EDNRB antibody
The protein encoded by this gene is a G protein-coupled receptor which activates a phosphatidylinositol-calcium second messenger system. Its ligand, endothelin, consists of a family of three potent vasoactive peptides: ET1, ET2, and ET3. Studies suggest that the multigenic disorder, Hirschsprung disease type 2, is due to mutations in the endothelin receptor type B gene. Alternative splicing and the use of alternative promoters results in multiple transcript variants.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58 kDa
NCBI Official Full Name
endothelin receptor type B isoform 1
NCBI Official Synonym Full Names
endothelin receptor type B
NCBI Official Symbol
EDNRB
NCBI Official Synonym Symbols
ETB; ET-B; ETB1; ETBR; ETRB; HSCR; WS4A; ABCDS; ET-BR; HSCR2
NCBI Protein Information
endothelin receptor type B
UniProt Protein Name
Endothelin B receptor
Protein Family
UniProt Gene Name
EDNRB
UniProt Synonym Gene Names
ETRB; ET-B; ET-BR
UniProt Entry Name
EDNRB_HUMAN

NCBI Description

The protein encoded by this gene is a G protein-coupled receptor which activates a phosphatidylinositol-calcium second messenger system. Its ligand, endothelin, consists of a family of three potent vasoactive peptides: ET1, ET2, and ET3. Studies suggest that the multigenic disorder, Hirschsprung disease type 2, is due to mutations in the endothelin receptor type B gene. Alternative splicing and the use of alternative promoters results in multiple transcript variants. [provided by RefSeq, Oct 2016]

Uniprot Description

ETB: a G protein-coupled receptor which activates a phosphatidylinoitol-calcium second messenger system. Its ligand, endothelin, consists of a family of three potent vasoactive peptides: ET1, ET2, and ET3. Studies suggest that the multigenic disorder, Hirschsprung disease type 2, is due to mutation in endothelin receptor type B gene. Essential component in the normal development of two neuronal crest-derived cell lineages. Two splice variant isoforms have been described.

Protein type: GPCR, family 1; Membrane protein, multi-pass; Receptor, GPCR; Membrane protein, integral

Chromosomal Location of Human Ortholog: 13q22

Cellular Component: nuclear membrane; integral to plasma membrane; plasma membrane; lipid raft

Molecular Function: endothelin receptor activity; protein binding; peptide hormone binding; type 1 angiotensin receptor binding

Biological Process: epithelial fluid transport; cGMP-mediated signaling; regulation of fever; negative regulation of cellular protein metabolic process; response to pain; negative regulation of transcription from RNA polymerase II promoter; vein smooth muscle contraction; sensory perception of pain; response to organic cyclic substance; enteric nervous system development; vasodilation; regulation of epithelial cell proliferation; elevation of cytosolic calcium ion concentration; cell surface receptor linked signal transduction; regulation of blood pressure; melanocyte differentiation; positive regulation of cell proliferation; regulation of pH; neural crest cell migration; aging; vasoconstriction; nervous system development; posterior midgut development; negative regulation of adenylate cyclase activity; macrophage chemotaxis; peripheral nervous system development; negative regulation of neuron maturation; G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); regulation of sensory perception of pain; positive regulation of protein amino acid phosphorylation; negative regulation of apoptosis

Disease: Abcd Syndrome; Waardenburg Syndrome, Type 4a; Hirschsprung Disease, Susceptibility To, 2

Research Articles on EDNRB

Similar Products

Product Notes

The EDNRB ednrb (Catalog #AAA3221538) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EDNRB Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EDNRB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the EDNRB ednrb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KRFKNCFKSC LCCWCQSFEE KQSLEEKQSC LKFKANDHGY DNFRSSNKYS. It is sometimes possible for the material contained within the vial of "EDNRB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.