Phosphatase 1 regulatory subunit 11 Recombinant Protein | PPP1R11 recombinant protein

Recombinant Human Protein phosphatase 1 regulatory subunit 11

Cat. Num. AAA717064

• Gene Names: PPP1R11; HCGV; IPP3; HCG-V; TCTE5; TCTEX5
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Phosphatase 1 regulatory subunit 11; Recombinant Human Protein phosphatase 1 regulatory subunit 11; Hemochromatosis candidate gene V protein; HCG V; Protein phosphatase inhibitor 3; PPP1R11 recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 1-126aa; Full Length
• Sequence: MAEAGAGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDNEHMGRRSSKCCCIYEKPRAFGESSTESDEEEEEGCGHTHCVRGHRKGRRRATLGPTPTTPPQPPDPSQPPPGPMQH
• Sequence Length: 126

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for PPP1R11 recombinant protein

Inhibitor of protein phosphatase 1.

References

Cloning of a human homologue of the mouse Tctex-5 gene within the MHC class I region.Giffon T., Lepourcelet M., Pichon L., Jezequel P., Bouric P., Carn G., Pontarotti P., Gall J.-Y., David V.Immunogenetics 44:331-339(1996) Systematic sequencing of the human HLA-A/HLA-F region establishment of a cosmid contig and identification of a new gene cluster within 37 kb of sequence.Lepourcelet M., Andrieux N., Giffon T., Pichon L., Hampe A., Galibert F., Mosser J.Genomics 37:316-326(1996) Homo sapiens 2,229,817bp genomic DNA of 6p21.3 HLA class I region.Shiina S., Tamiya G., Oka A., Inoko H.Genome diversity in HLA a new strategy for detection of genetic polymorphisms in expressed genes within the HLA class III and class I regions.Shiina T., Ota M., Takasu M., Katsuyama Y., Hashimoto N., Tokunaga K., Inoko H. The DNA sequence and analysis of human chromosome 6.Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D., Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.Nature 425:805-811(2003) Identification and characterization of the human HCG V gene product as a novel inhibitor of protein phosphatase-1.Zhang J., Zhang L., Zhao S., Lee E.Y.C.Biochemistry 37:16728-16734(1998) A quantitative atlas of mitotic phosphorylation.Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.Sci. Signal. 3:RA3-RA3(2010) N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.Van Damme P., Lasa M., Polevoda B., Gazquez C., Elosegui-Artola A., Kim D.S., De Juan-Pardo E., Demeyer K., Hole K., Larrea E., Timmerman E., Prieto J., Arnesen T., Sherman F., Gevaert K., Aldabe R.Proc. Natl. Acad. Sci. U.S.A. 109:12449-12454(2012)

NCBI and Uniprot Product Information

• NCBI GI #: 11386175
• NCBI GeneID: 6992
• NCBI Accession #: NP_068778.1
• NCBI GenBank Nucleotide #: NM_021959.2
• UniProt Accession #: O60927
• Molecular Weight: 41 kDa
• NCBI Official Full Name: protein phosphatase 1 regulatory subunit 11
• NCBI Official Synonym Full Names: protein phosphatase 1 regulatory inhibitor subunit 11
• NCBI Official Symbol: PPP1R11
• NCBI Official Synonym Symbols: HCGV; IPP3; HCG-V; TCTE5; TCTEX5
• NCBI Protein Information: protein phosphatase 1 regulatory subunit 11
• UniProt Protein Name: Protein phosphatase 1 regulatory subunit 11
• Protein Family: Protein phosphatase 1 regulatory
• UniProt Gene Name: PPP1R11
• UniProt Synonym Gene Names: HCGV; TCTE5; HCG V
• UniProt Entry Name: PP1RB_HUMAN

NCBI Description

This gene encodes a specific inhibitor of protein phosphatase-1 (PP1) with a differential sensitivity toward the metal-independent and metal-dependent forms of PP1. The gene is located within the major histocompatibility complex class I region on chromosome 6. [provided by RefSeq, Jul 2008]

Uniprot Description

PPP1R11: Inhibitor of protein phosphatase 1.

Protein type: Protein phosphatase, regulatory subunit; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: cytoplasm; nucleus; protein phosphatase type 1 complex

Molecular Function: protein binding; type 1 serine/threonine specific protein phosphatase inhibitor activity

Biological Process: negative regulation of phosphoprotein phosphatase activity