Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human THSD1 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 60-75 kDa.)

THSD1 recombinant protein

Recombinant Human THSD1 Protein

Gene Names
THSD1; TMTSP; ANIB12; UNQ3010
Purity
>95% by SDS-PAGE.
Synonyms
THSD1; Recombinant Human THSD1 Protein; TMTSP; UNQ3010; THSD1 recombinant protein
Ordering
For Research Use Only!
Host
HEK293 Cells
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
EYLLLREPGHVALSNDTVYVDFQYFDGANGTLRNVSVLLLEANTNQTVTTKYLLTNQSQGTLKFECFYFKEAGDYWFTMTPEATDNSTPFPWWEKSAFLKVEWPVFHVDLNRSAKAAEGTFQVGLFTSQPLCPFPVDKPNIVVDVIFTNSLPEARRNSRQPLEIRTSKRTELAQGQWVEFGCAPLGPEAYVTVVLKLLGRDSVITSTGPIDLAQKFGYKLVMVPELTCESGVEVTVLPPPCTFVQGVVTVFKEAPRYPGKRTIHLAENSLPLGERRTIFNCTLFDMGKNKYCFDFGISSRSHFSAKEECMLIQRNTAFQPSSPSPLQPQGPVKSNNI
Sequence Length
852
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human THSD1 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 60-75 kDa.)

SDS-Page (Recombinant Human THSD1 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 60-75 kDa.)
Related Product Information for THSD1 recombinant protein
Description: Recombinant Human THSD1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu 25 - Ile 361) of human THSD1 (Accession #NP_954872.1) fused with a 6xHis tag at the C-terminus.

Background: Human Thrombospondin type-1 domain-containing protein 1 (THSD1) also known as Transmembrane molecule with thrombospondin module (TMTSP), is a single-pass type I membrane protein. In addition, THSD1 is widely expressed on endothelial cells, with highest expression in the lung. THSD1’s ligand and function are unknown, but it is postulated that THSD1 may be involved in the regulation of vasculogenesis and/or angiogenesis through its interaction with its specific ligand.
Product Categories/Family for THSD1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
thrombospondin type-1 domain-containing protein 1 isoform 1
NCBI Official Synonym Full Names
thrombospondin type 1 domain containing 1
NCBI Official Symbol
THSD1
NCBI Official Synonym Symbols
TMTSP; ANIB12; UNQ3010
NCBI Protein Information
thrombospondin type-1 domain-containing protein 1
UniProt Protein Name
Thrombospondin type-1 domain-containing protein 1
UniProt Gene Name
THSD1
UniProt Synonym Gene Names
TMTSP
UniProt Entry Name
THSD1_HUMAN

NCBI Description

The protein encoded by this gene contains a type 1 thrombospondin domain, which is found in a number of proteins involved in the complement pathway, as well as in extracellular matrix proteins. Alternatively spliced transcript variants encoding different isoforms have been observed for this gene. [provided by RefSeq, Jan 2009]

Uniprot Description

THSD1: contains a type 1 thrombospondin domain, which is found in a number of proteins involved in the complement pathway, as well as in extracellular matrix proteins. Alternatively spliced transcript variants encoding different isoforms have been observed for this gene. [provided by RefSeq, Jan 2009]

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 13q14.3

Cellular Component: cell surface; cytoplasm; extracellular region; integral to membrane

Biological Process: hemopoietic progenitor cell differentiation

Research Articles on THSD1

Similar Products

Product Notes

The THSD1 thsd1 (Catalog #AAA9141803) is a Recombinant Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: EYLLLREPGH VALSNDTVYV DFQYFDGANG TLRNVSVLLL EANTNQTVTT KYLLTNQSQG TLKFECFYFK EAGDYWFTMT PEATDNSTPF PWWEKSAFLK VEWPVFHVDL NRSAKAAEGT FQVGLFTSQP LCPFPVDKPN IVVDVIFTNS LPEARRNSRQ PLEIRTSKRT ELAQGQWVEF GCAPLGPEAY VTVVLKLLGR DSVITSTGPI DLAQKFGYKL VMVPELTCES GVEVTVLPPP CTFVQGVVTV FKEAPRYPGK RTIHLAENSL PLGERRTIFN CTLFDMGKNK YCFDFGISSR SHFSAKEECM LIQRNTAFQP SSPSPLQPQG PVKSNNI. It is sometimes possible for the material contained within the vial of "THSD1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.