Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data

TIE-2, soluble Recombinant Protein | TIE-2 recombinant protein

Mouse TIE-2, soluble

Gene Names
Tek; Hyk; Tie2; tie-2; Cd202b; AA517024
Reactivity
Mouse
Purity
> 95% by SDS-PAGE & silver stain
Synonyms
TIE-2; soluble; Mouse TIE-2; Recombinant Mouse soluble TIE-2-His Receptor; Endothelial tyrosine kinase; Tyrosine kinase with Ig and EGF homology domains-2; CD202b; TIE-2 recombinant protein
Ordering
For Research Use Only!
Host
Insect Cells
Reactivity
Mouse
Purity/Purification
> 95% by SDS-PAGE & silver stain
Form/Format
Lyophilized
Sequence
AMDLILINSLPLVSDAETLTCIASGWHPHEPITIGRDFEALMNQHQDPLE VTQDVTREWAKKVVWKREKASKINGAYCEGRVRGQAIRIRTMKMRQQASF LPATLTMTVDRGDNVNISFKKVLIKEEDAVIYKNGSIHSVPRHEVPDILE VHLPHAQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQKWGPDCRPCTT CKNNGVCHEDTGECICPPGFMGRTCEKACEPHTFGRTCKERCSGPEGCKS YVFCPDPYGCSCATGWRGLQCNEACPSGYYGPDCKLRCHCTNEEICDRFQ GCLCSQGWQGLQCKEGRPRMTPQIEDLPDHIEVNSGKFNPICKASGWPLP TSEEMTLVKPDGTVLQPNDFNYDRFSVAIFTVNRVLPPDSGVWVCSVNTV AGMVEKPFNISVKVLPEPLHAPNVIDTGHNFIINISSEPYFGDGPIKSKK LFYKPVNQAWKYIEVTNEIFTLNYLEPRTDYELCVQLARPEGGEGHPGPV RRFTTASIGLPPPRGLSLLPKSQTALNLTWQPIFTNSEDEFYVEVERRSQ TTSDQQNIKVPGNLTSVLLSNLVPREQYTVRARVNTKAQGEWSEELRAWT LSDILPPQENIKISNITDSTAMVSWTIVDGYSISSIIIRYKVQGKNEDQH IDVKIKNATVTQYQLKGEPETTYHVDIFAENNIGSSNPAFSHELRTLPHS PASATRHHHHHH
Sequence Length
712
N Terminal Sequence
AMDLILINSL
Buffer
PBS
Preparation and Storage
Lyophilized samples are stable for greater than six months at -20 degree C to -70 degree C. Reconstituted sTIE-2-His should be stored in working aliquots at -20 degree C.

Testing Data

Testing Data
Related Product Information for TIE-2 recombinant protein
Recombinant mouse soluble TIE-2 was fused with a 6x His-tag at the C-terminus. The soluble receptor protein consists of the full extracellular domain (Ala23-Ala737). Mouse sTIE-2 monomer has a calculated molecular mass of approximately 79,86 kDa. As a result of glycosylation, the recombinant protein migrates as an approximately 95 kDa protein in SDS-PAGE under reducing conditions. TIE-1 (tyrosine kinase with Ig and EGF homology domains 1) and TIE-2/Tek comprise a receptor tyrosine kinase (RTK) subfamily with unique structural characteristics: two immunoglobulin-like domains flanking three epidermal growth factor (EGF)-like domains and followed by three fibronectin type III-like repeats in the extracellular region and a split tyrosine kinase domain in the cytoplasmic region. These receptors are expressed primarily on endothelial and hematopoietic progenitor cells and play critical roles in angiogenesis, vasculogenesis and hematopoiesis.
Product Categories/Family for TIE-2 recombinant protein
References
1. Partanen J and DJ Dumont (1999) Curr Top Microbiol Immunol 237:159. 2. Takakura N et al, (1998) Immunity 9:677. 3. Procopio W et al, (1999) J Biol Chem 274:30196.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
90 kDa
NCBI Official Full Name
Angiopoietin-1 receptor
NCBI Official Synonym Full Names
endothelial-specific receptor tyrosine kinase
NCBI Official Symbol
Tek
NCBI Official Synonym Symbols
Hyk; Tie2; tie-2; Cd202b; AA517024
NCBI Protein Information
angiopoietin-1 receptor; STK1; mTIE2; p140 TEK; endothelial tyrosine kinase; tyrosine-protein kinase receptor TEK; tunica interna endothelial cell kinase; tyrosine-protein kinase receptor TIE-2; tyrosine kinase with Ig and EGF homology domains-2
UniProt Protein Name
Angiopoietin-1 receptor
UniProt Gene Name
Tek
UniProt Synonym Gene Names
Hyk; Tie-2; Tie2; mTIE2
UniProt Entry Name
TIE2_MOUSE

Uniprot Description

Function: Tyrosine-protein kinase that acts as cell-surface receptor for ANGPT1, ANGPT2 and ANGPT4 and regulates angiogenesis, endothelial cell survival, proliferation, migration, adhesion and cell spreading, reorganization of the actin cytoskeleton, but also maintenance of vascular quiescence. Has anti-inflammatory effects by preventing the leakage of proinflammatory plasma proteins and leukocytes from blood vessels. Required for normal angiogenesis and heart development during embryogenesis. Required for post-natal hematopoiesis. After birth, activates or inhibits angiogenesis, depending on the context. Inhibits angiogenesis and promotes vascular stability in quiescent vessels, where endothelial cells have tight contacts. In quiescent vessels, ANGPT1 oligomers recruit TEK to cell-cell contacts, forming complexes with TEK molecules from adjoining cells, and this leads to preferential activation of phosphatidylinositol 3-kinase and the AKT1 signaling cascades. In migrating endothelial cells that lack cell-cell adhesions, ANGT1 recruits TEK to contacts with the extracellular matrix, leading to the formation of focal adhesion complexes, activation of PTK2/FAK and of the downstream kinases MAPK1/ERK2 and MAPK3/ERK1, and ultimately to the stimulation of sprouting angiogenesis. ANGPT1 signaling triggers receptor dimerization and autophosphorylation at specific tyrosine residues that then serve as binding sites for scaffold proteins and effectors. Signaling is modulated by ANGPT2 that has lower affinity for TEK, can promote TEK autophosphorylation in the absence of ANGPT1, but inhibits ANGPT1-mediated signaling by competing for the same binding site. Signaling is also modulated by formation of heterodimers with TIE1, and by proteolytic processing that gives rise to a soluble TEK extracellular domain. The soluble extracellular domain modulates signaling by functioning as decoy receptor for angiopoietins. TEK phosphorylates DOK2, GRB7, GRB14, PIK3R1, SHC1 and TIE1. Ref.8 Ref.9 Ref.10 Ref.11 Ref.13 Ref.15 Ref.16 Ref.18

Catalytic activity: ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate. Ref.8

Enzyme regulation: Angiopoietin binding leads to receptor dimerization and activation by autophosphorylation at Tyr-990 on the kinase activation loop

By similarity.

Subunit structure: Homodimer. Heterodimer with TIE1. Interacts with ANGPT1, ANGPT2 and ANGPT4. At cell-cell contacts in quiescent cells, forms a signaling complex composed of ANGPT1 plus TEK molecules from two adjoining cells. In the absence of endothelial cell-cell contacts, interaction with ANGPT1 mediates contacts with the extracellular matrix. Interacts (tyrosine phosphorylated) with TNIP2. Interacts (tyrosine phosphorylated) with SHC1 (via SH2 domain)

By similarity. Interacts with PTPRB; this promotes endothelial cell-cell adhesion. Interacts with DOK2, GRB2, GRB7, GRB14, PIK3R1 and PTPN11/SHP2. Colocalizes with DOK2 at contacts with the extracellular matrix in migrating cells. Ref.10 Ref.11 Ref.14 Ref.15 Ref.16 Ref.17 Ref.18

Subcellular location: Cell membrane; Single-pass type I membrane protein. Cell junction

By similarity. Cell junction › focal adhesion

By similarity. Cytoplasm › cytoskeleton

By similarity. Secreted

By similarity. Note: Recruited to cell-cell contacts in quiescent endothelial cells. Colocalizes with the actin cytoskeleton and at actin stress fibers during cell spreading. Recruited to the lower surface of migrating cells, especially the rear end of the cell. Proteolytic processing gives rise to a soluble extracellular domain that is secreted

By similarity.

Tissue specificity: Specifically expressed in developing vascular endothelial cells. Abundantly expressed in lung and heart, moderately in brain, liver and kidney, and weakly in thymus, spleen and testis. Ref.6

Developmental stage: Expression detectable in day 8.5 embryos.

Domain: The soluble extracellular domain is functionally active in angiopoietin binding and can modulate the activity of the membrane-bound form by competing for angiopoietins

By similarity. Ref.14

Post-translational modification: Proteolytic processing leads to the shedding of the extracellular domain (soluble TIE-2 alias sTIE-2)

By similarity.Autophosphorylated on tyrosine residues in response to ligand binding. Autophosphorylation occurs in trans, i.e. one subunit of the dimeric receptor phosphorylates tyrosine residues on the other subunit. Autophosphorylation occurs in a sequential manner, where Tyr-990 in the kinase activation loop is phosphorylated first, followed by autophosphorylation at Tyr-1106 and at additional tyrosine residues. ANGPT1-induced phosphorylation is impaired during hypoxia, due to increased expression of ANGPT2

By similarity. Phosphorylation is important for interaction with GRB14, PIK3R1 and PTPN11. Phosphorylation at Tyr-1100 is important for interaction with GRB2 and GRB7. Phosphorylation at Tyr-1106 is important for interaction with DOK2 and for coupling to downstream signal transduction pathways in endothelial cells. Dephosphorylated by PTPRB. Ref.12 Ref.15 Ref.16Ubiquitinated. The phosphorylated receptor is ubiquitinated and internalized, leading to its degradation

By similarity. Ref.12 Ref.15 Ref.16

Disruption phenotype: Embryonically lethal. Embryos die at about 10 dpc, due to strongly decreased numbers of blood vessel endothelial cells, leading to severe hemorrhaging, and due to defects in heart trabeculae development. Mice display a general malformation of the vascular network with defective sprouting and dilated blood vessels. Ref.8 Ref.9

Sequence similarities: Belongs to the protein kinase superfamily. Tyr protein kinase family. Tie subfamily.Contains 3 EGF-like domains.Contains 3 fibronectin type-III domains.Contains 2 Ig-like C2-type (immunoglobulin-like) domains.Contains 1 protein kinase domain.

Research Articles on TIE-2

Similar Products

Product Notes

The TIE-2 tek (Catalog #AAA691557) is a Recombinant Protein produced from Insect Cells and is intended for research purposes only. The product is available for immediate purchase. The Mouse TIE-2, soluble reacts with Mouse and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: AMDLILINSL PLVSDAETLT CIASGWHPHE PITIGRDFEA LMNQHQDPLE VTQDVTREWA KKVVWKREKA SKINGAYCEG RVRGQAIRIR TMKMRQQASF LPATLTMTVD RGDNVNISFK KVLIKEEDAV IYKNGSIHSV PRHEVPDILE VHLPHAQPQD AGVYSARYIG GNLFTSAFTR LIVRRCEAQK WGPDCRPCTT CKNNGVCHED TGECICPPGF MGRTCEKACE PHTFGRTCKE RCSGPEGCKS YVFCPDPYGC SCATGWRGLQ CNEACPSGYY GPDCKLRCHC TNEEICDRFQ GCLCSQGWQG LQCKEGRPRM TPQIEDLPDH IEVNSGKFNP ICKASGWPLP TSEEMTLVKP DGTVLQPNDF NYDRFSVAIF TVNRVLPPDS GVWVCSVNTV AGMVEKPFNI SVKVLPEPLH APNVIDTGHN FIINISSEPY FGDGPIKSKK LFYKPVNQAW KYIEVTNEIF TLNYLEPRTD YELCVQLARP EGGEGHPGPV RRFTTASIGL PPPRGLSLLP KSQTALNLTW QPIFTNSEDE FYVEVERRSQ TTSDQQNIKV PGNLTSVLLS NLVPREQYTV RARVNTKAQG EWSEELRAWT LSDILPPQEN IKISNITDST AMVSWTIVDG YSISSIIIRY KVQGKNEDQH IDVKIKNATV TQYQLKGEPE TTYHVDIFAE NNIGSSNPAF SHELRTLPHS PASATRHHHH HH. It is sometimes possible for the material contained within the vial of "TIE-2, soluble, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.