TIE-1, soluble Recombinant Protein | TIE-1 recombinant protein

Mouse TIE-1, soluble

Cat. Num. AAA691933

• Gene Names: Tie1; TIE; tie-1; D430008P04Rik
• Reactivity: Mouse
• Purity: > 95% by SDS-PAGE & silver stain
• Synonyms: TIE-1; soluble; Mouse TIE-1; Recombinant Mouse soluble TIE-1-His Receptor; Tyrosine-protein kinase Tie-1; TIE-1 recombinant protein

• Host: Insect Cells
• Reactivity: Mouse
• Purity/Purification: > 95% by SDS-PAGE & silver stain
• Form/Format: Lyophilized
• Sequence: SVDLTLLANLRITDPQRFFLTCVSGEAGAGRSSDPPLLLEKDDRIVRTFP PGQPLYLARNGSHQVTLRGFSKPSDLVGVFSCVGGAGARRTRVLYVHNSP GAHLFPDKVTHTVNKGDTAVLSAHVHKEKQTDVIWKNNGSYFNTLDWQEA DDGRFQLQLQNVQPPSSGIYSATYLEASPLGSAFFRLIVRGCGAGRWGPG CVKDCPGCLHGGVCHDHDGECVCPPGFTGTRCEQACREGRFGQSCQEQCP GTAGCRGLTFCLPDPYGCSCGSGWRGSQCQEACAPDHFGADCRLQCQCQN GGTCDRFSGCVCPSGWHGVHCEKSDRIPQILSMATEVEFNIGTMPRINCA AAGNPFPVRGSMKLRKPDGTMLLSTKVIVEPDRTTAEFEVPSLTLGDSGF WECRVSTSGGQDSRRFKVNVKVPPVPLTAPRLLAKQSRQLVVSPLVSFSG DGPISSVRLHYRPQDSTIAWSAIVVDPSENVTLMNLKPKTGYNVRVQLSR PGEGGEGGWGPSALMTTDCPEPLLQPWLESWHVEGPDRLRVSWSLPSVPL SGDGFLLRLWDGARGQERRENISFPQARTALLTGLTPGTHYQLDVRLYHC TLLGPASPPAHVHLPPSGPPAPRHLHAQALSDSEIQLMWQHPEAPSGPIS KYIVEIQVAGGSGDPQWMDVDRPEETSIIVRGLNASTRYLFRVRASVQGL GDWSNTVEEATLGNGLQSEDPVRESRATRHHHHHH
• Sequence Length: 735

• N Terminal Sequence: SVDLTLLANL
• Buffer: PBS
• Preparation and Storage: Lyophilized samples are stable for greater than six months at -20 degree C to -70 degree C. Reconstituted sTIE-1-His should be stored in working aliquots at -20 degree C.

Testing Data

Related Product Information for TIE-1 recombinant protein

Recombinant mouse soluble TIE-1 was fused with a 6x His-tag at the C-terminus. The soluble receptor protein consists of the full extracellular domain (Ser22-Ala748). Mouse sTIE-1 monomer has a calculated molecular mass of approximately 79,8 kDa. As a result of glycosylation, the recombinant protein migrates as an approximately 95 kDa protein in SDS-PAGE under reducing conditions. TIE-1 (tyrosine kinase with Ig and EGF homology domains 1) and TIE-2/Tek comprise a receptor tyrosine kinase (RTK) subfamily with unique structural characteristics: two immunoglobulin-like domains flanking three epidermal growth factor (EGF)-like domains and followed by three fibronectin type III-like repeats in the extracellular region and a split tyrosine kinase domain in the cytoplasmic region. These receptors are expressed primarily on endothelial and hematopoietic progenitor cells and play critical roles in angiogenesis, vasculogenesis and hematopoiesis.

Product Categories/Family for TIE-1 recombinant protein

Soluble receptors

References

1. Partanen J and DJ Dumont (1999) Curr Top Microbiol Immunol 237:159. 2. Takakura N et al, (1998) Immunity 9:677. 3. Procopio W et al, (1999) J Biol Chem 274:30196. 4. Sato et al., PNAS 90:9355, 1993 5. Gale et al., Gen Dev 13:1055, 1999

NCBI and Uniprot Product Information

• NCBI GI #: 144446133
• NCBI GeneID: 21846
• NCBI Accession #: NP_03517.2
• NCBI GenBank Nucleotide #: NM_011587.2
• UniProt Accession #: Q06806; Q811F4; Q8BGI2
• Molecular Weight: 95 kDa
• NCBI Official Full Name: tyrosine-protein kinase receptor Tie-1
• NCBI Official Synonym Full Names: tyrosine kinase with immunoglobulin-like and EGF-like domains 1
• NCBI Official Symbol: Tie1
• NCBI Official Synonym Symbols: TIE; tie-1; D430008P04Rik
• NCBI Protein Information: tyrosine-protein kinase receptor Tie-1; tyrosine kinase receptor 1
• UniProt Protein Name: Tyrosine-protein kinase receptor Tie-1
• UniProt Gene Name: Tie1
• UniProt Synonym Gene Names: Tie; Tie-1
• UniProt Entry Name: TIE1_MOUSE

Uniprot Description

Function: Transmembrane tyrosine-protein kinase that may modulate TEK/TIE2 activity and contribute to the regulation of angiogenesis

By similarity.

Catalytic activity: ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.

Subunit structure: Heterodimer with TEK/TIE2

By similarity.

Subcellular location: Cell membrane; Single-pass type I membrane protein

By similarity.

Tissue specificity: Specifically expressed in developing vascular endothelial cells. Abundantly expressed in lung and heart, moderately in brain, liver and kidney, and weakly in thymus, spleen and testis. Ref.3

Post-translational modification: Phosphorylated on tyrosine residues in response to ANGPT1, most likely by TEK/TIE2

By similarity.

Sequence similarities: Belongs to the protein kinase superfamily. Tyr protein kinase family. Tie subfamily.Contains 3 EGF-like domains.Contains 3 fibronectin type-III domains.Contains 2 Ig-like C2-type (immunoglobulin-like) domains.Contains 1 protein kinase domain.