Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to EXOSC8 on HeLa cell. [antibody concentration 15 ug/ml])
Mouse EXOSC8 Monoclonal Antibody | anti-EXOSC8 antibody
EXOSC8 (exosome Component 8, CIP3, EAP2, OIP2, RP11-421P11.3, RRP43, Rrp43p, bA421P11.3, p9) (AP)
Gene Names
EXOSC8; p9; CIP3; EAP2; OIP2; PCH1C; RRP43; Rrp43p; bA421P11.3
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
EXOSC8; Monoclonal Antibody; EXOSC8 (exosome Component 8; CIP3; EAP2; OIP2; RP11-421P11.3; RRP43; Rrp43p; bA421P11.3; p9) (AP); exosome Component 8; p9; anti-EXOSC8 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4B3
Specificity
Recognizes EXOSC8.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-EXOSC8 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
EXOSC8 (NP_852480.1, 177aa-276aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AEVNLKKKSYLNIRTHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTIVMDEEGKLCCLHKPGGSGLTGAKLQDCMSRAVTRHKEVKKLMDEVIKSMKPK
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to EXOSC8 on HeLa cell. [antibody concentration 15 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to EXOSC8 on HeLa cell. [antibody concentration 15 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to EXOSC8 on HeLa cell. [antibody concentration 15 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to EXOSC8 on HeLa cell. [antibody concentration 15 ug/ml])
Related Product Information for anti-EXOSC8 antibody
This gene encodes a 3'-5' exoribonuclease that specifically interacts with mRNAs containing AU-rich elements. The encoded protein is part of the exosome complex that is important for the degradation of numerous RNA species. A pseudogene of this gene is found on chromosome 6. [provided by RefSeq]
Product Categories/Family for anti-EXOSC8 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
30,040 Da
NCBI Official Full Name
Homo sapiens exosome component 8 (EXOSC8), mRNA
NCBI Official Synonym Full Names
exosome component 8
NCBI Official Symbol
EXOSC8
NCBI Official Synonym Symbols
p9; CIP3; EAP2; OIP2; PCH1C; RRP43; Rrp43p; bA421P11.3
NCBI Protein Information
exosome complex component RRP43; CBP-interacting protein 3; OIP-2; Opa interacting protein 2; exosome complex exonuclease RRP43; opa-interacting protein 2; ribosomal RNA-processing protein 43
Protein Family
NCBI Description
This gene encodes a 3'-5' exoribonuclease that specifically interacts with mRNAs containing AU-rich elements. The encoded protein is part of the exosome complex that is important for the degradation of numerous RNA species. A pseudogene of this gene is found on chromosome 6. [provided by RefSeq, Mar 2009]
Research Articles on EXOSC8
Similar Products
Product Notes
The EXOSC8 (Catalog #AAA6164660) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's EXOSC8 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EXOSC8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EXOSC8, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
