TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L (Taf5l) Recombinant Protein | Taf5l recombinant protein
Recombinant Mouse TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L (Taf5l)
Gene Names
Taf5l; AI849020; 1110005N04Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L (Taf5l); Recombinant Mouse TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L (Taf5l); Taf5l recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-589, Full length protein
Sequence
MKRVRTEQVQVAVSCYLKRRQYVDSEGPLKQGLRLSQTPEEMAANLTVQSESGCANAVSAAPCQAEPQQYEVQFGRLRSFLTDSDSQYSREVMPLLYPLFVYLHLNLVQSGPKSTVESFYSRFHGMFLQNASQKDVIEQLQTTQTIQDILSNFQLRAFLDNKYVVRLQEDSYNYLIRYLQSDNNTALCKVLAVHIHLDVQPAKRTDYQLYASGGSSRTENSSLEPPEVPSPILQNEAALEVLQESIKRVKDGPPSLTTICFYAFYNTEQLLNTAEISSDSKLLAAGFDNSCIKLWSLRSKKLKSEPHHVDTSRIRLACDTLEEEENEEDNTGTEMKILRGHCGPVYSTRFLADSSGLLSCSEDMSIRYWDLGSFTNTVLYQGHAYPVWDVDISPFSLYFASGSHDRTARLWSFDRTYPLRIYAGHLADVDCVKFHPNSNYLATGSTDKTVRLWSAQQGNSVRLFTGHRGPVLSLSFSPNGKYLASAGEDQRLKLWDLASGTLFKELRGHTDSITSLAFSPDSGLIASASMDNSVRVWDIRSTCCNTPADGSSGELVGVYTGQMSNVLSVQFMACNLLLVTGITQENQEH
Sequence Length
589
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Taf5l recombinant protein
The product of this gene belongs to the WD-repeat TAF5 family of proteins. This gene encodes a protein that is a component of the PCAF histone acetylase complex. The PCAF histone acetylase complex, which is composed of more than 20 polypeptides some of which are TAFs, is required for myogenic transcription and differentiation. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors to facilitate complex assembly and transcription initiation. The encoded protein is structurally similar to one of the histone-like TAFs, TAF5. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
65,911 Da
NCBI Official Full Name
TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L
NCBI Official Synonym Full Names
TATA-box binding protein associated factor 5 like
NCBI Official Symbol
Taf5l
NCBI Official Synonym Symbols
AI849020; 1110005N04Rik
NCBI Protein Information
TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L
UniProt Protein Name
TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L
UniProt Gene Name
Taf5l
UniProt Synonym Gene Names
Paf65b; PAF65-beta
Uniprot Description
Functions as a component of the PCAF complex. The PCAF complex is capable of efficiently acetylating histones in a nucleosomal context. The PCAF complex could be considered as the human version of the yeast SAGA complex ().
Similar Products
Product Notes
The Taf5l taf5l (Catalog #AAA1311411) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-589, Full length protein. The amino acid sequence is listed below: MKRVRTEQVQ VAVSCYLKRR QYVDSEGPLK QGLRLSQTPE EMAANLTVQS ESGCANAVSA APCQAEPQQY EVQFGRLRSF LTDSDSQYSR EVMPLLYPLF VYLHLNLVQS GPKSTVESFY SRFHGMFLQN ASQKDVIEQL QTTQTIQDIL SNFQLRAFLD NKYVVRLQED SYNYLIRYLQ SDNNTALCKV LAVHIHLDVQ PAKRTDYQLY ASGGSSRTEN SSLEPPEVPS PILQNEAALE VLQESIKRVK DGPPSLTTIC FYAFYNTEQL LNTAEISSDS KLLAAGFDNS CIKLWSLRSK KLKSEPHHVD TSRIRLACDT LEEEENEEDN TGTEMKILRG HCGPVYSTRF LADSSGLLSC SEDMSIRYWD LGSFTNTVLY QGHAYPVWDV DISPFSLYFA SGSHDRTARL WSFDRTYPLR IYAGHLADVD CVKFHPNSNY LATGSTDKTV RLWSAQQGNS VRLFTGHRGP VLSLSFSPNG KYLASAGEDQ RLKLWDLASG TLFKELRGHT DSITSLAFSP DSGLIASASM DNSVRVWDIR STCCNTPADG SSGELVGVYT GQMSNVLSVQ FMACNLLLVT GITQENQEH. It is sometimes possible for the material contained within the vial of "TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L (Taf5l), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
