Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged PIGW is 0.3 ng/ml as a capture antibody.)

Mouse PIGW Monoclonal Antibody | anti-PIGW antibody

PIGW (Phosphatidylinositol Glycan Anchor Biosynthesis, Class W, FLJ37433, Gwt1) (Biotin)

Gene Names
PIGW; Gwt1; HPMRS5
Applications
Western Blot
Purity
Purified
Synonyms
PIGW; Monoclonal Antibody; PIGW (Phosphatidylinositol Glycan Anchor Biosynthesis; Class W; FLJ37433; Gwt1) (Biotin); Phosphatidylinositol Glycan Anchor Biosynthesis; Gwt1; anti-PIGW antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D8
Specificity
Recognizes PIGW.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-PIGW antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PIGW (NP_848612.2, 399aa-447aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KFLIKGALVPCSWKLIQSPVTNKKHSESLVPEAERMEPSLCLITALNRK
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged PIGW is 0.3 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PIGW is 0.3 ng/ml as a capture antibody.)

Western Blot (WB)

(PIGW monoclonal antibody (M05), clone 1D8. Western Blot analysis of PIGW expression in MCF-7.)

Western Blot (WB) (PIGW monoclonal antibody (M05), clone 1D8. Western Blot analysis of PIGW expression in MCF-7.)
Related Product Information for anti-PIGW antibody
Mouse monoclonal antibody raised against a partial recombinant PIGW.
Product Categories/Family for anti-PIGW antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56,882 Da
NCBI Official Full Name
phosphatidylinositol-glycan biosynthesis class W protein
NCBI Official Synonym Full Names
phosphatidylinositol glycan anchor biosynthesis, class W
NCBI Official Symbol
PIGW
NCBI Official Synonym Symbols
Gwt1; HPMRS5
NCBI Protein Information
phosphatidylinositol-glycan biosynthesis class W protein; PIG-W; phosphatidylinositol glycan, class W
UniProt Protein Name
Phosphatidylinositol-glycan biosynthesis class W protein
UniProt Gene Name
PIGW
UniProt Synonym Gene Names
PIG-W

NCBI Description

Glycosylphosphatidylinositol (GPI) is a complex glycolipid that anchors many proteins to the cell surface. PIGW acts in the third step of GPI biosynthesis and acylates the inositol ring of phosphatidylinositol (Murakami et al., 2003 [PubMed 14517336]).[supplied by OMIM, Mar 2008]

Uniprot Description

PIGW: Probable acetyltransferase, which acetylates the inositol ring of phosphatidylinositol during biosynthesis of GPI- anchor. Acetylation during GPI-anchor biosynthesis is not essential for the subsequent mannosylation and is usually removed soon after the attachment of GPIs to proteins. Belongs to the PIGW family.

Protein type: EC 2.3.-.-; Endoplasmic reticulum; Glycan Metabolism - glycosylphosphatidylinositol (GPI)-anchor biosynthesis; Membrane protein, integral; Membrane protein, multi-pass; Transferase

Chromosomal Location of Human Ortholog: 17q12

Cellular Component: endoplasmic reticulum membrane; integral component of membrane

Molecular Function: O-acyltransferase activity

Biological Process: GPI anchor metabolic process; preassembly of GPI anchor in ER membrane

Disease: Hyperphosphatasia With Mental Retardation Syndrome 5

Similar Products

Product Notes

The PIGW pigw (Catalog #AAA6174652) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PIGW can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PIGW pigw for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PIGW, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.