Synaptogyrin-1 (SYNGR1) Recombinant Protein | SYNGR1 recombinant protein

Recombinant Human Synaptogyrin-1 (SYNGR1)

Cat. Num. AAA7057218

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Synaptogyrin-1 (SYNGR1); Recombinant Human Synaptogyrin-1 (SYNGR1); Synaptogyrin-1; SYNGR1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 170-233. Partial
• Sequence: QRYQIGADSALFSQDYMDPSQDSSMPYAPYVEPTGPDPAGMGGTYQQPANTFDTEPQGYQSQGY

• Species: Homo sapiens (Human)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

Related Product Information for SYNGR1 recombinant protein

Involved in the regulation of short-term and long-term synaptic plasticity.

Product Categories/Family for SYNGR1 recombinant protein

Neuroscience

References

"Characterization of the human synaptogyrin gene family." Kedra D., Pan H.-Q., Seroussi E., Fransson I., Guilbaud C., Collins J.E., Dunham I., Blennow E., Roe B.A., Piehl F., Dumanski J.P. Hum. Genet. 103:131-141(1998)

NCBI and Uniprot Product Information

• NCBI GI #: 22035696
• NCBI GeneID: 9145
• NCBI Accession #: NP_004702.2
• NCBI GenBank Nucleotide #: NM_004711.4
• UniProt Accession #: O43759; O43757; O43758; Q53Y02; Q96J56; Q9UGZ4; A6NP69; A8K0E2
• Molecular Weight: 48 kDa
• NCBI Official Full Name: synaptogyrin-1 isoform 1a
• NCBI Official Synonym Full Names: synaptogyrin 1
• NCBI Official Symbol: SYNGR1
• NCBI Protein Information: synaptogyrin-1
• UniProt Protein Name: Synaptogyrin-1
• Protein Family: Synaptogyrin
• UniProt Gene Name: SYNGR1

NCBI Description

This gene encodes an integral membrane protein associated with presynaptic vesicles in neuronal cells. The exact function of this protein is unclear, but studies of a similar murine protein suggest that it functions in synaptic plasticity without being required for synaptic transmission. The gene product belongs to the synaptogyrin gene family. Three alternatively spliced variants encoding three different isoforms have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

May play a role in regulated exocytosis. Modulates the localization of synaptophysin/SYP into synaptic-like microvesicles and may therefore play a role in synaptic-like microvesicle formation and/or maturation (). Involved in the regulation of short-term and long-term synaptic plasticity ().