Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SASP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Lung)

Rabbit SASP Polyclonal Antibody | anti-ASPRV1 antibody

SASP antibody - middle region

Gene Names
ASPRV1; MUNO; SASP; Taps; SASPase
Reactivity
Guinea Pig, Horse, Human, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SASP; Polyclonal Antibody; SASP antibody - middle region; anti-ASPRV1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Guinea Pig, Horse, Human, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RGEALGVYNRLSPQDQGDYGTVKEALLKAFGVPGAAPSHLPKEIVFANSM
Sequence Length
343
Applicable Applications for anti-ASPRV1 antibody
Western Blot (WB)
Homology
Guinea Pig: 92%; Horse: 100%; Human: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SASP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SASP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Lung)

Western Blot (WB) (WB Suggested Anti-SASP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Lung)
Related Product Information for anti-ASPRV1 antibody
This is a rabbit polyclonal antibody against SASP. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The specific function of SASP is not yet known.
Product Categories/Family for anti-ASPRV1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
retroviral-like aspartic protease 1
NCBI Official Synonym Full Names
aspartic peptidase retroviral like 1
NCBI Official Symbol
ASPRV1
NCBI Official Synonym Symbols
MUNO; SASP; Taps; SASPase
NCBI Protein Information
retroviral-like aspartic protease 1
UniProt Protein Name
Retroviral-like aspartic protease 1
UniProt Gene Name
ASPRV1
UniProt Synonym Gene Names
SASPase; Skin aspartic protease; TAPS
UniProt Entry Name
APRV1_HUMAN

NCBI Description

Filaggrin is a structural protein that is crucial for in the development and maintenance of the skin barrier. This gene encodes a retroviral-like protease involved in profilaggrin-to-filaggrin processing. Expression is found primarily in the epidermis and inner root sheath of hair follicles. [provided by RefSeq, May 2017]

Uniprot Description

ASPRV1: Homodimer (Potential).

Protein type: Protease; Membrane protein, integral; EC 3.4.23.-

Chromosomal Location of Human Ortholog: 2p13.3

Cellular Component: integral to membrane

Molecular Function: aspartic-type endopeptidase activity

Biological Process: skin development; protein processing; proteolysis

Research Articles on ASPRV1

Similar Products

Product Notes

The ASPRV1 asprv1 (Catalog #AAA3211135) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SASP antibody - middle region reacts with Guinea Pig, Horse, Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SASP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ASPRV1 asprv1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RGEALGVYNR LSPQDQGDYG TVKEALLKAF GVPGAAPSHL PKEIVFANSM. It is sometimes possible for the material contained within the vial of "SASP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.