Serine/arginine-rich splicing factor 8 (SRSF8) Recombinant Protein | SRSF8 recombinant protein
Recombinant Human Serine/arginine-rich splicing factor 8 (SRSF8)
Gene Names
SRSF8; DSM-1; SRP46; SFRS2B
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Serine/arginine-rich splicing factor 8 (SRSF8); Recombinant Human Serine/arginine-rich splicing factor 8 (SRSF8); SRSF8 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-282, Full length protein
Sequence
SCGRPPPDVDGMITLKVDNLTYRTSPDSLRRVFEKYGRVGDVYIPREPHTKAPRGFAFVRFHDRRDAQDAEAAMDGAELDGRELRVQVARYGRRDLPRSRQGEPRGRSRGGGYGRRSRSYGRRSRSPRRRHRSRSRGPSCSRSRSRSRYRGSRYSRSPYSRSPYSRSRYSRSPYSRSRYRESRYGGSHYSSSGYSNSRYSRYHSSRSHSKSGSSTSSRSASTSKSSSARRSKSSSVSRSRSRSRSSSMTRSPPRVSKRKSKSRSRSKRPPKSPEEEGQMSS
Sequence Length
281
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for SRSF8 recombinant protein
The SR (serine
arginine-rich) family contains a number of phosphoproteins that function as essential and alternative splicing factors. The SR family of proteins is characterized by the presence of a ribonucleoprotein (RNP)-type RNA binding motif and a carboxyl-terminal arginine-serine-rich (RS) domain. This protein is a member of the SR family and functions as an essential splicing factor in vitro. This gene is thought to be an expressed PR264
SC35 retropseudogene.
arginine-rich) family contains a number of phosphoproteins that function as essential and alternative splicing factors. The SR family of proteins is characterized by the presence of a ribonucleoprotein (RNP)-type RNA binding motif and a carboxyl-terminal arginine-serine-rich (RS) domain. This protein is a member of the SR family and functions as an essential splicing factor in vitro. This gene is thought to be an expressed PR264
SC35 retropseudogene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
31,425 Da
NCBI Official Full Name
serine/arginine-rich splicing factor 8
NCBI Official Synonym Full Names
serine and arginine rich splicing factor 8
NCBI Official Symbol
SRSF8
NCBI Official Synonym Symbols
DSM-1; SRP46; SFRS2B
NCBI Protein Information
serine/arginine-rich splicing factor 8
UniProt Protein Name
Serine/arginine-rich splicing factor 8
Protein Family
UniProt Gene Name
SRSF8
UniProt Synonym Gene Names
SFRS2B; SRP46; Splicing factor SRp46
NCBI Description
This gene encodes a member of a family of proteins containing a ribonucleoprotein (RNP)-type RNA binding motif and a carboxyl-terminal arginine-serine-rich (RS) domain. The encoded protein functions as a pre-mRNA splicing factor. There is a pseudogene for this gene on chromosome 7. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2013]
Uniprot Description
Involved in pre-mRNA alternative splicing.
Similar Products
Product Notes
The SRSF8 srsf8 (Catalog #AAA1423713) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-282, Full length protein. The amino acid sequence is listed below: SCGRPPPDVD GMITLKVDNL TYRTSPDSLR RVFEKYGRVG DVYIPREPHT KAPRGFAFVR FHDRRDAQDA EAAMDGAELD GRELRVQVAR YGRRDLPRSR QGEPRGRSRG GGYGRRSRSY GRRSRSPRRR HRSRSRGPSC SRSRSRSRYR GSRYSRSPYS RSPYSRSRYS RSPYSRSRYR ESRYGGSHYS SSGYSNSRYS RYHSSRSHSK SGSSTSSRSA STSKSSSARR SKSSSVSRSR SRSRSSSMTR SPPRVSKRKS KSRSRSKRPP KSPEEEGQMS S. It is sometimes possible for the material contained within the vial of "Serine/arginine-rich splicing factor 8 (SRSF8), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
