Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using SRSF8 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

Rabbit anti-Mouse SRSF8 Polyclonal Antibody | anti-SRSF8 antibody

SRSF8 Rabbit pAb

Gene Names
SRSF8; DSM-1; SRP46; SFRS2B
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purification
Synonyms
SRSF8; Polyclonal Antibody; SRSF8 Rabbit pAb; DSM-1; SFRS2B; SRP46; anti-SRSF8 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MSCGRPPPDVDGMITLKVDNLTYRTSPDSLRRVFEKYGRVGDVYIPREPHTKAPRGFAFVRFHDRRDAQDAEAAMDGAELDGRELRVQVARYGRRDLPRS
Applicable Applications for anti-SRSF8 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SRSF8 (NP_115285.1).
Positive Samples
Mouse brain, Mouse heart, Mouse kidney
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using SRSF8 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using SRSF8 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)
Related Product Information for anti-SRSF8 antibody
Background: This gene encodes a member of a family of proteins containing a ribonucleoprotein (RNP)-type RNA binding motif and a carboxyl-terminal arginine-serine-rich (RS) domain. The encoded protein functions as a pre-mRNA splicing factor. There is a pseudogene for this gene on chromosome 7. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-SRSF8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32,288 Da
NCBI Official Full Name
serine/arginine-rich splicing factor 8
NCBI Official Synonym Full Names
serine/arginine-rich splicing factor 8
NCBI Official Symbol
SRSF8
NCBI Official Synonym Symbols
DSM-1; SRP46; SFRS2B
NCBI Protein Information
serine/arginine-rich splicing factor 8; SR splicing factor 8; splicing factor SRp46; pre-mRNA-splicing factor SRP46; splicing factor, arginine/serine-rich 2B; splicing factor, arginine/serine-rich, 46kD
UniProt Protein Name
Serine/arginine-rich splicing factor 8
UniProt Gene Name
SRSF8
UniProt Synonym Gene Names
SFRS2B; SRP46; Splicing factor SRp46
UniProt Entry Name
SRSF8_HUMAN

NCBI Description

This gene encodes a member of a family of proteins containing a ribonucleoprotein (RNP)-type RNA binding motif and a carboxyl-terminal arginine-serine-rich (RS) domain. The encoded protein functions as a pre-mRNA splicing factor. There is a pseudogene for this gene on chromosome 7. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2013]

Uniprot Description

SRp46: Involved in pre-mRNA alternative splicing. Belongs to the splicing factor SR family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: RNA-binding

Chromosomal Location of Human Ortholog: 11q22

Cellular Component: nucleus

Molecular Function: protein binding; nucleotide binding

Biological Process: RNA splicing; mRNA processing

Similar Products

Product Notes

The SRSF8 srsf8 (Catalog #AAA9142608) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SRSF8 Rabbit pAb reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's SRSF8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the SRSF8 srsf8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSCGRPPPDV DGMITLKVDN LTYRTSPDSL RRVFEKYGRV GDVYIPREPH TKAPRGFAFV RFHDRRDAQD AEAAMDGAEL DGRELRVQVA RYGRRDLPRS. It is sometimes possible for the material contained within the vial of "SRSF8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.