Suppressor of cytokine signaling 3 Recombinant Protein | Socs3 recombinant protein

Recombinant Rat Suppressor of cytokine signaling 3

Cat. Num. AAA1169806

• Gene Names: Socs3; Cish3; Ssi-3; Socs-3
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Suppressor of cytokine signaling 3; Recombinant Rat Suppressor of cytokine signaling 3; Cytokine-inducible SH2 protein 3; Socs3 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-225. Full-length.
• Sequence: MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVETQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV LKLVHHYMPPPGAPSFSLPPTEPSFEVQEQPPAQALPGGTPKRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
• Sequence Length: 225

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for Socs3 recombinant protein

SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. SOCS3 is involved in negative regulation of cytokines that signal through the JAK/STAT pathway. Inhibits cytokine signal transduction by binding to tyrosine kinase receptors including gp130, LIF, erythropoietin, insulin, IL12, GCSF and leptin receptors. Binding to JAK2 inhibits its kinase activity. Suppresses fetal liver erythropoiesis. Regulates onset and maintenance of allergic responses mediated by T-helper type 2 cells. Regulates IL-6 signaling in vivo. Probable substrate-recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Ses to recognize IL6ST.

References

Endotoxin-induced inhibition of growth hormone receptor signaling in rat liver in vivo.Mao Y., Ling P.R., Fitzgibbons T.P., McCowen K.C., Frick G.P., Bistrian B.R., Smith R.J.Endocrinology 140:5505-5515(1999) le Cam A. Identification of the Y985 and Y1077 motifs as SOCS3 recruitment sites in the murine leptin receptor.Eyckerman S., Broekaert D., Verhee A., Vandekerckhove J., Tavernier J.FEBS Lett. 486:33-37(2000)

NCBI and Uniprot Product Information

• NCBI GI #: 16758336
• NCBI GeneID: 89829
• NCBI Accession #: NP_446017.1
• NCBI GenBank Nucleotide #: NM_053565.1
• UniProt Accession #: O88583; Q9QYV5
• Molecular Weight: 26.8 kDa
• NCBI Official Full Name: suppressor of cytokine signaling 3
• NCBI Official Synonym Full Names: suppressor of cytokine signaling 3
• NCBI Official Symbol: Socs3
• NCBI Official Synonym Symbols: Cish3; Ssi-3; Socs-3
• NCBI Protein Information: suppressor of cytokine signaling 3
• UniProt Protein Name: Suppressor of cytokine signaling 3
• Protein Family: Suppressor of cytokine signaling
• UniProt Gene Name: Socs3
• UniProt Synonym Gene Names: Cish3; SOCS-3
• UniProt Entry Name: SOCS3_RAT

NCBI Description

regulates cytokine levels to modulate inflammation [RGD, Feb 2006]

Uniprot Description

SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. SOCS3 is involved in negative regulation of cytokines that signal through the JAK/STAT pathway. Inhibits cytokine signal transduction by binding to tyrosine kinase receptors including gp130, LIF, erythropoietin, insulin, IL12, GCSF and leptin receptors. Binding to JAK2 inhibits its kinase activity. Suppresses fetal liver erythropoiesis. Regulates onset and maintenance of allergic responses mediated by T-helper type 2 cells. Regulates IL-6 signaling in vivo. Probable substrate-recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Seems to recognize IL6ST ().