Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Phosphate carrier protein (Slc25a3) Recombinant Protein | Slc25a3 recombinant protein

Recombinant Mouse Phosphate carrier protein, mitochondrial (Slc25a3)

Gene Names
Slc25a3; PTP; Phc; 5730556H19Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Phosphate carrier protein (Slc25a3); Recombinant Mouse Phosphate carrier protein; mitochondrial (Slc25a3); Slc25a3 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
46-357aa; full length protein
Sequence
AVEEYSCEFGSMKYYALCGFGGVLSCGLTHTAVVPLDLVKCRMQVDPQKYKGIFNGFSIT LKEDGVRGLAKGWAPTLIGYSMQGLCKFGFYEVFKALYSNILGEENTYLWRTSLYLASSA SAEFFADIALAPMEAAKVRIQTQPGYANTLREAVPKMYKEEGLNAFYKGVAPLWMRQIPY TMMKFACFERTVEALYKFVVPKPRSECTKAEQLVVTFVAGYIAGVFCAIVSHPADSVVSV LNKEKGSTASQVLQRLGFRGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEM PESLKKKLGLTE
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Slc25a3 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,632 Da
NCBI Official Full Name
phosphate carrier protein, mitochondrial
NCBI Official Synonym Full Names
solute carrier family 25 (mitochondrial carrier, phosphate carrier), member 3
NCBI Official Symbol
Slc25a3
NCBI Official Synonym Symbols
PTP; Phc; 5730556H19Rik
NCBI Protein Information
phosphate carrier protein, mitochondrial
UniProt Protein Name
Phosphate carrier protein, mitochondrial
UniProt Gene Name
Slc25a3
UniProt Synonym Gene Names
PTP
UniProt Entry Name
MPCP_MOUSE

Uniprot Description

SLC25A3: Transport of phosphate groups from the cytosol to the mitochondrial matrix. Phosphate is cotransported with H(+). Defects in SLC25A3 are a cause of mitochondrial phosphate carrier deficiency (MPCD). MPCD is a fatal disorder of oxidative phosphorylation. Patients have lactic acidosis, hypertrophic cardiomyopathy and muscular hypotonia and die within the first year of life. Belongs to the mitochondrial carrier family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transporter, SLC family; Transporter; Mitochondrial; Membrane protein, integral; Membrane protein, multi-pass

Cellular Component: integral to membrane; membrane; mitochondrial inner membrane; mitochondrion; myelin sheath; nucleolus; nucleus

Molecular Function: protein complex binding; structural constituent of ribosome; symporter activity

Biological Process: translation; transport

Research Articles on Slc25a3

Similar Products

Product Notes

The Slc25a3 slc25a3 (Catalog #AAA7029925) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 46-357aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Slc25a3 slc25a3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AVEEYSCEFG SMKYYALCGF GGVLSCGLTH TAVVPLDLVK CRMQVDPQKY KGIFNGFSIT LKEDGVRGLA KGWAPTLIGY SMQGLCKFGF YEVFKALYSN ILGEENTYLW RTSLYLASSA SAEFFADIAL APMEAAKVRI QTQPGYANTL REAVPKMYKE EGLNAFYKGV APLWMRQIPY TMMKFACFER TVEALYKFVV PKPRSECTKA EQLVVTFVAG YIAGVFCAIV SHPADSVVSV LNKEKGSTAS QVLQRLGFRG VWKGLFARII MIGTLTALQW FIYDSVKVYF RLPRPPPPEM PESLKKKLGL TE. It is sometimes possible for the material contained within the vial of "Phosphate carrier protein (Slc25a3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.