SH2B adapter protein 1 (SH2B1) Recombinant Protein | SH2B1 recombinant protein

Recombinant Human SH2B adapter protein 1 (SH2B1)(T484A,V541A), partial

Cat. Num. AAA9018615

• Gene Names: SH2B1; PSM; SH2B
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: SH2B adapter protein 1 (SH2B1); Recombinant Human SH2B adapter protein 1 (SH2B1)(T484A; V541A); partial; SH2B adapter protein 1(Pro-rich; PH and SH2 domain-containing signaling mediator)(PSM)(SH2 domain-containing protein 1B); SH2B1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 246-671aa(T484A, V541A), Partial of Isoform 2
• Sequence: MVQREELLSFMGAEEAAPDPAGVGRGGGVAGPPSGGGGQPQWQKCRLLLRSEGEGGGGSRLEFFVPPKASRPRLSIPCSSITDVRTTTALEMPDRENTFVVKVEGPSEYIMETVDAQHVKAWVSDIQECLSPGPCPATSPRPMTLPLAPGTSFLTRENTDSLELSCLNHSESLPSQDLLLGPSESNDRLSQGAYGGLSDRPSASISPSSASIAASHFDSMELLPPELPPRIPIEEGPPAGTVHPLSAPYPPLDTPETATGSFLFQGEPEGGEGDQPLSGYPWFHGMLSRLKAAQLALTGGTGSHGVFLVRQSETRRGEYVLTFNFQGKAKHLRLSLNEEGQCRVQHLWFQSIFDMLEHFRVHPIPLESGGSSDVVLVSYVPSSQRQQGREQAGSHAGVCEGDGCHPDASCTLMPFGASDCVTDHLP

• Species: Homo sapiens (Human)
• Relevance: Adapter protein for several members of the tyrosine kinase receptor family. Involved in multiple signaling pathways mediated by Janus kinase (JAK) and receptor tyrosine kinases, including the receptors of insulin (INS), insulin-like growth factor I (IGF1), nerve growth factor (NGF), brain-derived neurotrophic factor (BDNF), glial cell line-derived neurotrophic factor (GDNF), platelet-derived growth factor (PDGF) and fibroblast growth factors (FGFs). In growth hormone (GH) signaling, autophosphorylated ('Tyr-813') JAK2 recruits SH2B1, which in turn is phosphorylated by JAK2 on tyrosine residues. These phosphotyrosines form potential binding sites for other signaling proteins. GH also promotes serine/threonine phosphorylation of SH2B1 and these phosphorylated residues may serve to recruit other proteins to the GHR-JAK2-SH2B1 complexes, such as RAC1. In leptin (LEP) signaling, binds to and potentiates the activation of JAK2 by globally enhancing downstream pathways. In response to leptin, binds simultaneously to both, JAK2 and IRS1 or IRS2, thus mediating formation of a complex of JAK2, SH2B1 and IRS1 or IRS2. Mediates tyrosine phosphorylation of IRS1 and IRS2, resulting in activation of the PI 3-kinase pathway. Acts as positive regulator of NGF-mediated activation of the Akt/Forkhead pathway; prolongs NGF-induced phosphorylation of AKT1 on 'Ser-473' and AKT1 enzymatic activity. Enhances the kinase activity of the cytokine receptor-associated tyrosine kinase JAK2 and of other receptor tyrosine kinases, such as FGFR3 and NTRK1. For JAK2, the mechanism seems to involve dimerization of both, SH2B1 and JAK2. Enhances RET phosphorylation and kinase activity. Isoforms seem to be differentially involved in IGF-I and PDGF-induced mitogenesis (By similarity).
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

Product Categories/Family for SH2B1 recombinant protein

Epigenetics and Nuclear Signaling

References

"SH2B1beta adaptor is a key enhancer of RET tyrosine kinase signaling."Donatello S., Fiorino A., Degl'Innocenti D., Alberti L., Miranda C., Gorla L., Bongarzone I., Rizzetti M.G., Pierotti M.A., Borrello M.G.Oncogene 26:6546-6559(2007)

NCBI and Uniprot Product Information

• NCBI GI #: 224926826
• NCBI GeneID: 25970
• NCBI Accession #: NP_001139267.1
• NCBI GenBank Nucleotide #: NM_001145795.1
• UniProt Accession #: Q9NRF2; Q96FK3; Q96SX3; Q9NRF1; Q9NRF3; Q9P2P7; Q9Y3Y3; A8K2R7
• Molecular Weight: 72,188 Da
• NCBI Official Full Name: SH2B adapter protein 1 isoform 1
• NCBI Official Synonym Full Names: SH2B adaptor protein 1
• NCBI Official Symbol: SH2B1
• NCBI Official Synonym Symbols: PSM; SH2B
• NCBI Protein Information: SH2B adapter protein 1; SH2 domain-containing protein 1B; SH2 domain-containing putative adapter SH2-B; SH2-B signaling protein; pro-rich, PH and SH2 domain-containing signaling mediator
• UniProt Protein Name: SH2B adapter protein 1
• Protein Family: SH2B adapter protein
• UniProt Gene Name: SH2B1
• UniProt Synonym Gene Names: KIAA1299; SH2B; PSM
• UniProt Entry Name: SH2B1_HUMAN

NCBI Description

This gene encodes a member of the SH2-domain containing mediators family. The encoded protein mediates activation of various kinases and may function in cytokine and growth factor receptor signaling and cellular transformation. Alternatively spliced transcript variants have been described. [provided by RefSeq, Mar 2009]

Uniprot Description

SH2-B-beta: an adaptor protein that specifically activates JAK2 and serve as adapter proteins for JAK1, -2 and -3. YXXL motifs in SH2-Bbeta are phosphorylated by JAK2, JAK1, and platelet-derived growth factor receptor and are required for membrane ruffling.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 16p11.2

Cellular Component: membrane; cytosol; nucleus

Molecular Function: signal transducer activity; protein binding

Biological Process: lamellipodium biogenesis; positive regulation of mitosis; blood coagulation