Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CAMK1 AntibodyTitration: 1.0 ug/mlPositive Control: A549 Whole CellCAMK1 is supported by BioGPS gene expression data to be expressed in A549)

Rabbit CAMK1 Polyclonal Antibody | anti-CAMK1 antibody

CAMK1 antibody - N-terminal region

Gene Names
CAMK1; CAMKI
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CAMK1; Polyclonal Antibody; CAMK1 antibody - N-terminal region; anti-CAMK1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAKEALEGKEGSMENEIAVL
Sequence Length
370
Applicable Applications for anti-CAMK1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CAMK1 AntibodyTitration: 1.0 ug/mlPositive Control: A549 Whole CellCAMK1 is supported by BioGPS gene expression data to be expressed in A549)

Western Blot (WB) (WB Suggested Anti-CAMK1 AntibodyTitration: 1.0 ug/mlPositive Control: A549 Whole CellCAMK1 is supported by BioGPS gene expression data to be expressed in A549)
Related Product Information for anti-CAMK1 antibody
This is a rabbit polyclonal antibody against CAMK1. It was validated on Western Blot

Target Description: Calcium/calmodulin-dependent protein kinase I is expressed in many tissues and is a component of a calmodulin-dependent protein kinase cascade. Calcium/calmodulin directly activates calcium/calmodulin-dependent protein kinase I by binding to the enzyme and indirectly promotes the phosphorylation and synergistic activation of the enzyme by calcium/calmodulin-dependent protein kinase I kinase.
Product Categories/Family for anti-CAMK1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
calcium/calmodulin-dependent protein kinase type 1
NCBI Official Synonym Full Names
calcium/calmodulin dependent protein kinase I
NCBI Official Symbol
CAMK1
NCBI Official Synonym Symbols
CAMKI
NCBI Protein Information
calcium/calmodulin-dependent protein kinase type 1
UniProt Protein Name
Calcium/calmodulin-dependent protein kinase type 1
UniProt Gene Name
CAMK1
UniProt Synonym Gene Names
CaM-KI; CaMKI-alpha
UniProt Entry Name
KCC1A_HUMAN

NCBI Description

Calcium/calmodulin-dependent protein kinase I is expressed in many tissues and is a component of a calmodulin-dependent protein kinase cascade. Calcium/calmodulin directly activates calcium/calmodulin-dependent protein kinase I by binding to the enzyme and indirectly promotes the phosphorylation and synergistic activation of the enzyme by calcium/calmodulin-dependent protein kinase I kinase. [provided by RefSeq, Jul 2008]

Uniprot Description

CAMK1A: an ubiquitous protein kinase of the CAMK1 family. Activated by Ca(2+)/calmodulin. Must be phosphorylated to be maximally active. Substrates include synapsin I.

Protein type: Kinase, protein; Protein kinase, Ser/Thr (non-receptor); Protein kinase, CAMK; EC 2.7.11.17; CAMK group; CAMK1 family

Chromosomal Location of Human Ortholog: 3p25.3

Cellular Component: cytoplasm; nucleus

Molecular Function: calmodulin binding; protein binding; calmodulin-dependent protein kinase activity; ATP binding

Biological Process: positive regulation of syncytium formation by plasma membrane fusion; regulation of muscle cell differentiation; nucleocytoplasmic transport; signal transduction; cell cycle; protein amino acid phosphorylation; positive regulation of peptidyl-serine phosphorylation; positive regulation of protein export from nucleus; positive regulation of synapse structural plasticity; regulation of protein localization; regulation of protein binding; positive regulation of muscle cell differentiation; positive regulation of transcription from RNA polymerase II promoter; negative regulation of protein binding

Research Articles on CAMK1

Similar Products

Product Notes

The CAMK1 camk1 (Catalog #AAA3216184) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CAMK1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CAMK1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CAMK1 camk1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DFRDVLGTGA FSEVILAEDK RTQKLVAIKC IAKEALEGKE GSMENEIAVL. It is sometimes possible for the material contained within the vial of "CAMK1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.