SDS-PAGE
Regenerating islet-derived protein 3-alpha Recombinant Protein | Reg3a recombinant protein
Recombinant Rat Regenerating islet-derived protein 3-alpha
Gene Names
Reg3a; Pap2; PapII
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Regenerating islet-derived protein 3-alpha; Recombinant Rat Regenerating islet-derived protein 3-alpha; Islet of Langerhans regenerating protein 3; REG 3; Lithostathine 3; Pancreatitis-associated protein 2; RegIII; Regenerating islet-derived protein III-alpha; Reg III-alpha; Reg3a recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
26-174aa; Full Length of Mature Protein
Sequence
EDSQKAVPSTRTSCPMGSKAYRSYCYTLVTTLKSWFQADLACQKRPSGHLVSILSGGEASFVSSLVTGRVNNNQDIWIWLHDPTMGQQPNGGGWEWSNSDVLNYLNWDGDPSSTVNRGNCGSLTATSEFLKWGDHHCDVELPFVCKFKQ
Sequence Length
174
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for Reg3a recombinant protein
Bactericidal C-type lectin. Regulates keratinocyte proliferation and differentiation after skin injury via activation of EXTL3-PI3K-AKT signaling pathway.
References
Identification of a second rat pancreatitis-associated protein. Messenger RNA cloning, gene structure, and expression during acute pancreatitis.Frigerio J.-M., Dusetti N.J., Keim V., Dagorn J.-C., Iovanna J.L.Biochemistry 32:9236-9241(1993)
Structure and expression of a novel rat RegIII gene.Suzuki Y., Yonekura H., Watanabe T., Unno M., Moriizumi S., Miyashita H., Okamoto H.Gene 144:315-316(1994)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20.5 kDa
NCBI Official Full Name
regenerating islet-derived protein 3-alpha
NCBI Official Synonym Full Names
regenerating islet-derived 3 alpha
NCBI Official Symbol
Reg3a
NCBI Official Synonym Symbols
Pap2; PapII
NCBI Protein Information
regenerating islet-derived protein 3-alpha
UniProt Protein Name
Regenerating islet-derived protein 3-alpha
Protein Family
UniProt Gene Name
Reg3a
UniProt Synonym Gene Names
Pap2; Reg3; REG-3-alpha; REG 3; Reg III-alpha
UniProt Entry Name
REG3A_RAT
NCBI Description
lectin-related secretory protein; overexpressed during the acute phase of pancreatitis [RGD, Feb 2006]
Uniprot Description
REG3A: Might be a stress protein involved in the control of bacterial proliferation.
Protein type: Secreted; Secreted, signal peptide
Cellular Component: extracellular region
Molecular Function: carbohydrate binding
Biological Process: acute-phase response; negative regulation of keratinocyte differentiation
Research Articles on Reg3a
Similar Products
Product Notes
The Reg3a reg3a (Catalog #AAA963283) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 26-174aa; Full Length of Mature Protein. The amino acid sequence is listed below: EDSQKAVPST RTSCPMGSKA YRSYCYTLVT TLKSWFQADL ACQKRPSGHL VSILSGGEAS FVSSLVTGRV NNNQDIWIWL HDPTMGQQPN GGGWEWSNSD VLNYLNWDGD PSSTVNRGNC GSLTATSEFL KWGDHHCDVE LPFVCKFKQ. It is sometimes possible for the material contained within the vial of "Regenerating islet-derived protein 3-alpha, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
