Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CXCR2 blocking peptide

CXCR2 Peptide - C-terminal region

Gene Names
Cxcr2; Il8rb; Cmkar2
Reactivity
Rat
Synonyms
CXCR2; CXCR2 Peptide - C-terminal region; CXCR2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Rat
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: LGFLHSCLNPIIYAFIGQKFRHGLLKIMANYGLVSKEFLAKEGRPSFVGS
Sequence Length
359
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for CXCR2 blocking peptide
This is a synthetic peptide designed for use in combination with anti- CXCR2 Antibody, made

Target Description: chemokine receptor that binds Il8, GRO/MGSA and neutrophil activating peptide-2; involved in the inflammatory response.
Product Categories/Family for CXCR2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39 kDa
NCBI Official Full Name
C-X-C chemokine receptor type 2
NCBI Official Synonym Full Names
C-X-C motif chemokine receptor 2
NCBI Official Symbol
Cxcr2
NCBI Official Synonym Symbols
Il8rb; Cmkar2
NCBI Protein Information
C-X-C chemokine receptor type 2
UniProt Protein Name
C-X-C chemokine receptor type 2
Protein Family
UniProt Gene Name
Cxcr2
UniProt Synonym Gene Names
Il8rb; CXC-R2; CXCR-2; IL-8R B

NCBI Description

chemokine receptor that binds Il8, GRO/MGSA and neutrophil activating peptide-2; involved in the inflammatory response [RGD, Feb 2006]

Uniprot Description

Receptor for interleukin-8 which is a powerful neutrophil chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. Binds to IL-8 with high affinity. Also binds with high affinity to CXCL3, GRO/MGSA and NAP-2 ().

Research Articles on CXCR2

Similar Products

Product Notes

The CXCR2 cxcr2 (Catalog #AAA3248186) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The CXCR2 Peptide - C-terminal region reacts with Rat and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: LGFLHSCLNP IIYAFIGQKF RHGLLKIMAN YGLVSKEFLA KEGRPSFVGS. It is sometimes possible for the material contained within the vial of "CXCR2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.