Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

C-X-C chemokine receptor type 2 (CXCR2) Recombinant Protein | CXCR2 recombinant protein

Recombinant Human C-X-C chemokine receptor type 2 (CXCR2), partial

Gene Names
CXCR2; CD182; IL8R2; IL8RA; IL8RB; CMKAR2; CDw128b
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
C-X-C chemokine receptor type 2 (CXCR2); Recombinant Human C-X-C chemokine receptor type 2 (CXCR2); partial; CDw128b; GRO/MGSA receptor; High affinity interleukin-8 receptor B; IL-8R B; IL-8 receptor type 2; CD_antigen: CD182; CXCR2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-40. Partial
Sequence
MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCE
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for CXCR2 recombinant protein
Receptor for interleukin-8 which is a powerful neutrophil chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. Binds to IL-8 with high affinity. Also binds with high affinity to CXCL3, GRO/MGSA and NAP-2.
Product Categories/Family for CXCR2 recombinant protein
References
"Cloning of complementary DNA encoding a functional human interleukin-8 receptor." Murphy P.M., Tiffany H.L. Science 253:1280-1283(1991)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20.6 kDa
NCBI Official Full Name
C-X-C chemokine receptor type 2
NCBI Official Synonym Full Names
chemokine (C-X-C motif) receptor 2
NCBI Official Symbol
CXCR2
NCBI Official Synonym Symbols
CD182; IL8R2; IL8RA; IL8RB; CMKAR2; CDw128b
NCBI Protein Information
C-X-C chemokine receptor type 2
UniProt Protein Name
C-X-C chemokine receptor type 2
Protein Family
UniProt Gene Name
CXCR2
UniProt Synonym Gene Names
IL8RB; CXC-R2; CXCR-2; IL-8R B
UniProt Entry Name
CXCR2_HUMAN

NCBI Description

The protein encoded by this gene is a member of the G-protein-coupled receptor family. This protein is a receptor for interleukin 8 (IL8). It binds to IL8 with high affinity, and transduces the signal through a G-protein activated second messenger system. This receptor also binds to chemokine (C-X-C motif) ligand 1 (CXCL1/MGSA), a protein with melanoma growth stimulating activity, and has been shown to be a major component required for serum-dependent melanoma cell growth. This receptor mediates neutrophil migration to sites of inflammation. The angiogenic effects of IL8 in intestinal microvascular endothelial cells are found to be mediated by this receptor. Knockout studies in mice suggested that this receptor controls the positioning of oligodendrocyte precursors in developing spinal cord by arresting their migration. This gene, IL8RA, a gene encoding another high affinity IL8 receptor, as well as IL8RBP, a pseudogene of IL8RB, form a gene cluster in a region mapped to chromosome 2q33-q36. Alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Nov 2009]

Uniprot Description

IL-8R B: Receptor for interleukin-8 which is a powerful neutrophil chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. Binds to IL-8 with high affinity. Also binds with high affinity to CXCL3, GRO/MGSA and NAP-2. Belongs to the G-protein coupled receptor 1 family.

Protein type: Membrane protein, multi-pass; GPCR, family 1; Receptor, GPCR; Receptor, cytokine; Membrane protein, integral

Chromosomal Location of Human Ortholog: 2q35

Cellular Component: cell surface; cytosol; integral to plasma membrane; intracellular; mast cell granule; membrane; plasma membrane

Molecular Function: C-X-C chemokine receptor activity; interleukin-8 binding; interleukin-8 receptor activity; protein binding; signal transducer activity

Biological Process: acute inflammatory response to antigenic stimulus; cell surface receptor linked signal transduction; cellular defense response; chemotaxis; dendritic cell chemotaxis; elevation of cytosolic calcium ion concentration; G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); inflammatory response; midbrain development; negative regulation of neutrophil apoptosis; neutrophil activation; neutrophil chemotaxis; positive regulation of angiogenesis; positive regulation of cell proliferation; positive regulation of vascular permeability; receptor internalization; signal transduction

Research Articles on CXCR2

Similar Products

Product Notes

The CXCR2 cxcr2 (Catalog #AAA949885) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-40. Partial. The amino acid sequence is listed below: MEDFNMESDS FEDFWKGEDL SNYSYSSTLP PFLLDAAPCE. It is sometimes possible for the material contained within the vial of "C-X-C chemokine receptor type 2 (CXCR2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.