RAET1E recombinant protein

RAET1E, human recombinant

Cat. Num. AAA847120

• Gene Names: RAET1E; RL-4; LETAL; ULBP4; N2DL-4; NKG2DL4; RAET1E2; bA350J20.7
• Purity: >=90% by SDS-PAGE
• Synonyms: RAET1E; human recombinant; NKG2D ligand 4; bA350J20.7; LETAL; N2DL-4; NKG2DL4; RAET1E2; RL-4; ULBP4; RAET1E recombinant protein

• Host: E Coli
• Purity/Purification: >=90% by SDS-PAGE
• Form/Format: Liquid. 1mg/ml in 20mM Tris-HCl buffer (pH8.0) containing 10% glycerol, and 0.4 M Urea.
• Concentration: 1mg/ml (varies by lot)
• Sequence: MGSSHHHHHHSSGLVPRGSHMGSMHSLCFNFTIKSLSRPGQPWCEAQVFLNKNLFLQYNSDNNMVKPLGLLGKKVYATSTWGELTQTLGEVGRDLRMLLCDIKPQIKTSDPSTLQVEMFCQREAERCTGASWQFATNGEKSLLFDAMNMTWTVINHEASKIKETWKKDRGLEKYFRKLSKGDCDHWLREFLGHWEAMPEPTVSPVNASDIHWSSSSLPDGQEKNGCCVGGGFDETLAFSGRLTGFNIWDSVLSNEEIRETGGAESCHIRGNIVGWGVTEIQPHGGAQYVS

• Gene Source: Human
• Endotoxin: <1.0 EU per 1 microgram of protein
• Dry Ice Shipment: Extra charge fee may add to your shipping cost as dry ice is required to ship this product.
• Preparation and Storage: Store at -80 degree C.; Centrifuge the vial prior to opening.; Shipping: Dry Ice; Shelf life: ~12 months

SDS-Page

Related Product Information for RAET1E recombinant protein

RAET1E belongs to the RAET1 family, which consists of major histocompatibility complex (MHC) class I-related genes located in a cluster on chromosome 6q24.2-q25.3. RAET1E and RAET1G protein differ from other RAET1 proteins in that they have type I membrane-spanning sequences at their C termini rather than glycosylphosphatidylinositol anchor sequences. This protein functions as a ligand for NKG2D receptor, which is expressed on the surface of several types of immune cells, and is involved in innate adaptive immune responses. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. Recombinant human RAET1E protein, fused to His-tag at N-terminus, was expressed in E Coli.

Product Categories/Family for RAET1E recombinant protein

Cytokines; Growth Factors & Hormones; Cytokines & Growth Factors (A-Z); Proteins; Enzymes; Proteins & Enzymes (A-Z)

NCBI and Uniprot Product Information

• NCBI GI #: 343183381
• NCBI GeneID: 135250
• NCBI Accession #: NP_001230254.1
• NCBI GenBank Nucleotide #: NM_001243325.1
• UniProt Accession #: Q8TD07; Q5VYB7; Q5VYB8; Q8TEZ2; Q96L41; A6YF59
• Molecular Weight: 23,978 Da
• NCBI Official Full Name: NKG2D ligand 4 isoform 2
• NCBI Official Synonym Full Names: retinoic acid early transcript 1E
• NCBI Official Symbol: RAET1E
• NCBI Official Synonym Symbols: RL-4; LETAL; ULBP4; N2DL-4; NKG2DL4; RAET1E2; bA350J20.7
• NCBI Protein Information: NKG2D ligand 4
• UniProt Protein Name: NKG2D ligand 4
• Protein Family: Retinoic acid early-inducible protein
• UniProt Gene Name: RAET1E
• UniProt Synonym Gene Names: LETAL; N2DL4; ULBP4; N2DL-4; NKG2DL4; RL-4
• UniProt Entry Name: N2DL4_HUMAN

Uniprot Description

RAET1E: Ligand for the NKG2D receptor. Delivers activating signals to NK cells and promotes tumor immune surveillance by inducing the expansion of anti-tumor cytotoxic lymphocytes. Belongs to the MHC class I family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 6q25.1

Cellular Component: plasma membrane

Molecular Function: antigen binding; natural killer cell lectin-like receptor binding

Biological Process: antigen processing and presentation; natural killer cell mediated cytotoxicity; regulation of immune response; T cell mediated cytotoxicity