Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP319265HPWb1 could indicate that this peptide derived from E.coli-expressed Human respiratory syncytial virus A (strain RSS-2) F."}, {"url":"https://www.cusabio.com/uploadfile/protein/1/CSB-EP319265HPWb1-2.jpg)

respiratory syncytial virus A Fusion glycoprotein F0 (F) Recombinant Protein | F recombinant protein

Recombinant Human respiratory syncytial virus A Fusion glycoprotein F0 (F), partial

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
respiratory syncytial virus A Fusion glycoprotein F0 (F); Recombinant Human respiratory syncytial virus A Fusion glycoprotein F0 (F); partial; F recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
27-529aa
Sequence
NITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKSAVTELQLLMQSTPATNNRARRELPRFMNYTLNNTKNTNVTLSKKRKRRFLGFLLGVGSAIASGIAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPLAETCKVQSNRVFCDTMNSLTLPSEVNLCNIDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKDRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITT
Sequence Length
Partial
Organism
Human respiratory syncytial virus A (strain RSS-2)
Tag Information
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C.
The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

SDS-Page

(Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP319265HPWb1 could indicate that this peptide derived from E.coli-expressed Human respiratory syncytial virus A (strain RSS-2) F."}, {"url":"https://www.cusabio.com/uploadfile/protein/1/CSB-EP319265HPWb1-2.jpg)

SDS-Page (Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP319265HPWb1 could indicate that this peptide derived from E.coli-expressed Human respiratory syncytial virus A (strain RSS-2) F."}, {"url":"https://www.cusabio.com/uploadfile/protein/1/CSB-EP319265HPWb1-2.jpg)
Related Product Information for F recombinant protein
During virus entry, induces fusion of viral and cellular membranes leading to delivery of the nucleocapsid into the cytoplasm. The fusogenic activity is inactive untill entry into host cell endosome, where a furin-like protease cleaves off a small peptide between F1 and F2. Interacts directly with heparan sulfate and may participate in virus attachment. Furthermore, the F2 subunit was identifed as the major determinant of RSV host cell specificity. Later in infection, proteins F expressed at the plasma membrane of infected cells can mediate fusion with adjacent cells to form syncytia, a cytopathic effect that could lead to tissue necrosis. The fusion protein is also able to trigger p53-dependent apoptosis.
References
"Structural characterization of the human respiratory syncytial virus fusion protein core." Zhao X., Singh M., Malashkevich V.N., Kim P.S.Proc. Natl. Acad. Sci. U.S.A. 97:14172-14177 (2000)

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
60.8 kDa
NCBI Official Full Name
Fusion glycoprotein F0
UniProt Protein Name
Fusion glycoprotein F0
UniProt Gene Name
F

Uniprot Description

During virus entry, induces fusion of viral and cellular membranes leading to delivery of the nucleocapsid into the cytoplasm. The fusogenic activity is inactive untill entry into host cell endosome, where a furin-like protease cleaves off a small peptide between F1 and F2. Interacts directly with heparan sulfate and may participate in virus attachment. Furthermore, the F2 subunit was identifed as the major determinant of RSV host cell specificity. Later in infection, proteins F expressed at the plasma membrane of infected cells can mediate fusion with adjacent cells to form syncytia, a cytopathic effect that could lead to tissue necrosis. The fusion protein is also able to trigger p53-dependent apoptosis.

Similar Products

Product Notes

The F f (Catalog #AAA7110919) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 27-529aa with tag N-terminal 10xHis-tagged and C-terminal Myc-tagged. The amino acid sequence is listed below: NITEEFYQST CSAVSKGYLS ALRTGWYTSV ITIELSNIKE NKCNGTDAKV KLIKQELDKY KSAVTELQLL MQSTPATNNR ARRELPRFMN YTLNNTKNTN VTLSKKRKRR FLGFLLGVGS AIASGIAVSK VLHLEGEVNK IKSALLSTNK AVVSLSNGVS VLTSKVLDLK NYIDKQLLPI VNKQSCSISN IETVIEFQQK NNRLLEITRE FSVNAGVTTP VSTYMLTNSE LLSLINDMPI TNDQKKLMSN NVQIVRQQSY SIMSIIKEEV LAYVVQLPLY GVIDTPCWKL HTSPLCTTNT KEGSNICLTR TDRGWYCDNA GSVSFFPLAE TCKVQSNRVF CDTMNSLTLP SEVNLCNIDI FNPKYDCKIM TSKTDVSSSV ITSLGAIVSC YGKTKCTASN KDRGIIKTFS NGCDYVSNKG VDTVSVGNTL YYVNKQEGKS LYVKGEPIIN FYDPLVFPSD EFDASISQVN EKINQSLAFI RKSDELLHNV NAGKSTTNIM ITT. It is sometimes possible for the material contained within the vial of "respiratory syncytial virus A Fusion glycoprotein F0 (F), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.