Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Protein Tyrosine Phosphatase Receptor Type C (PTPRC) Recombinant Protein | PTPRC recombinant protein

Recombinant Protein Tyrosine Phosphatase Receptor Type C (PTPRC)

Gene Names
Ptprc; loc; B220; Cd45; L-CA; Ly-5; T200; CD45R; Lyt-4
Applications
SDS-Page, Western Blot, ELISA, Immunoprecipitation
Purity
> 95%
Synonyms
Protein Tyrosine Phosphatase Receptor Type C (PTPRC); Recombinant Protein Tyrosine Phosphatase Receptor Type C (PTPRC); PTPRC recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
> 95%
Form/Format
Supplied as lyophilized form in PBS,pH7.4, containing 5% sucrose, 0.01% sarcosyl.
Sequence
The target protein is fused with two N-terminal Tags, His-tag and S-tag, its sequence is listed below.
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-DLGIPETPKP SCGDPAARKT LVSWPEPVSK PESASKPHGY VLCYKNNSEK CKSLPNNVTS FEVESLKPYK YYEVSLLAYV NGKIQRNGTA EKCNFHTKAD RPDKVNGMKT SRPTDNSINV TCGPPYETNG PKTFYILVVR SGGSFVTKYN KTNCQFYVDN LYYSTDYEFL VSFHNGVYEG DSVIRN
Sequence Length
1291
Applicable Applications for PTPRC recombinant protein
SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP)
Organism
Mus musculus (Mouse)
Expression System
Prokaryotic expression
Residues
Asp371~Asn556 (Accession # P06800) with two N-terminal Tags, His-tag and S-tag
Endotoxin Level
<1.0EU per 1ug (determined by the LAL method)
Reconstitution
Reconstitute in sterile PBS, pH7.2-pH7.4.
Preparation and Storage
Avoid repeated freeze/thaw cycles. Store at 2-8 degree C for one month. Aliquot and store at -80 degree C for 12 months.
Stability Test: The thermal stability is described by the loss rate of the targetprotein. The loss rate was determined by accelerated thermal degradation test,that is, incubate the protein at 37 degree C for 48h, and no obvious degradation andprecipitation were observed. (Referring from China Biological Products Standard,which was calculated by the Arrhenius equation.) The loss of this protein is lessthan 5% within the expiration date under appropriate storage condition.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
26.6kDa
NCBI Official Full Name
Receptor-type tyrosine-protein phosphatase C
NCBI Official Synonym Full Names
protein tyrosine phosphatase, receptor type, C
NCBI Official Symbol
Ptprc
NCBI Official Synonym Symbols
loc; B220; Cd45; L-CA; Ly-5; T200; CD45R; Lyt-4
NCBI Protein Information
receptor-type tyrosine-protein phosphatase C; lymphocyte antigen 5; leukocyte common antigen; lymphocyte common antigen
UniProt Protein Name
Receptor-type tyrosine-protein phosphatase C
UniProt Gene Name
Ptprc
UniProt Synonym Gene Names
Ly-5; L-CA; Ly-5
UniProt Entry Name
PTPRC_MOUSE

Uniprot Description

CD45: a receptor type protein tyrosine phosphatase protein. Contains an extracellular domain, a single transmembrane segment and two tandem intracytoplasmic catalytic domains. The first PTPAse domain has enzymatic activity, while the second one seems to affect the substrate specificity of the first one. Specifically expressed in hematopoietic cells. An essential regulator of T- and B-cell antigen receptor signaling. Functions through either direct interaction with components of the antigen receptor complexes, or by activating various Src family kinases required for the antigen receptor signaling. Suppresses JAK kinases, and thus functions as a regulator of cytokine receptor signaling. Four alternatively spliced isoforms have been described.

Protein type: Membrane protein, integral; EC 3.1.3.48; Motility/polarity/chemotaxis; Receptor protein phosphatase, tyrosine

Cellular Component: focal adhesion; cell surface; membrane; integral to plasma membrane; plasma membrane; integral to membrane; intracellular; cytosol; external side of plasma membrane

Molecular Function: heparan sulfate proteoglycan binding; heparin binding; protein binding; hydrolase activity; phosphoric monoester hydrolase activity; protein tyrosine phosphatase activity; protein kinase binding; phosphoprotein phosphatase activity

Biological Process: B cell proliferation; positive regulation of isotype switching to IgG isotypes; activation of MAPK activity; regulation of humoral immune response mediated by circulating immunoglobulin; positive regulation of T cell mediated cytotoxicity; regulation of cell cycle; protein amino acid dephosphorylation; T cell receptor signaling pathway; T cell proliferation; B cell receptor signaling pathway; leukocyte adhesion; positive regulation of MAPKKK cascade; negative regulation of T cell mediated cytotoxicity; positive regulation of B cell proliferation; positive regulation of T cell mediated immunity; response to gamma radiation; positive regulation of T cell proliferation; negative regulation of protein amino acid autophosphorylation; negative regulation of cytokine and chemokine mediated signaling pathway; positive regulation of gamma-delta T cell differentiation; defense response to virus; T cell differentiation; positive thymic T cell selection; regulation of B cell receptor signaling pathway; positive regulation of humoral immune response mediated by circulating immunoglobulin; negative regulation of peptidyl-tyrosine phosphorylation; substrate-bound cell migration, cell release from substrate; positive regulation of antigen receptor-mediated signaling pathway; negative thymic T cell selection; bone marrow development; heterotypic cell-cell adhesion; stem cell development; dephosphorylation; positive regulation of T cell differentiation; B cell differentiation; release of sequestered calcium ion into cytosol; regulation of B cell differentiation; negative regulation of protein kinase activity; hemopoietic progenitor cell differentiation; positive regulation of alpha-beta T cell proliferation; immunoglobulin biosynthetic process

Research Articles on PTPRC

Similar Products

Product Notes

The PTPRC ptprc (Catalog #AAA2011971) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Protein Tyrosine Phosphatase Receptor Type C (PTPRC) can be used in a range of immunoassay formats including, but not limited to, SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP). Researchers should empirically determine the suitability of the PTPRC ptprc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: The target protein is fused with two N-terminal Tags, His-tag and S-tag, its sequence is listed below. MHHHHHHSSG LVPRGSGMKE TAAAKFERQH MDSPDLGTDD DDKAMADIGS EF-DLGIPET PKP SCGDPAARKT LVSWPEPVSK PESASKPHGY VLCYKNNSEK CKSLPNNVTS FEVESLKPYK YYEVSLLAYV NGKIQRNGTA EKCNFHTKAD RPDKVNGMKT SRPTDNSINV TCGPPYETNG PKTFYILVVR SGGSFVTKYN KTNCQFYVDN LYYSTDYEFL VSFHNGVYEG DSVIRN. It is sometimes possible for the material contained within the vial of "Protein Tyrosine Phosphatase Receptor Type C (PTPRC), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.