Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Protein phosphatase 1 regulatory subunit 12A (Ppp1r12a) Recombinant Protein | Ppp1r12a recombinant protein

Recombinant Mouse Protein phosphatase 1 regulatory subunit 12A (Ppp1r12a) , partial

Gene Names
Ppp1r12a; Mypt1; AA792106; AV099298; D10Ertd625e; 1200015F06Rik; 5730577I22Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein phosphatase 1 regulatory subunit 12A (Ppp1r12a); Recombinant Mouse Protein phosphatase 1 regulatory subunit 12A (Ppp1r12a); partial; Ppp1r12a recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
853-946. Partial.
Sequence
GVSFWTQDSDENEQERQSDTEDGSSKRETQTDSVSRYDSSSTSSSDRYDSLLGRSASYSYLEDRKPYSSRLEKDDSTDFKKLYEQILAENEKLK
Sequence Length
946
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Ppp1r12a recombinant protein
Myosin phosphatase target subunit 1, which is also called the myosin-binding subunit of myosin phosphatase, is one of the subunits of myosin phosphatase. Myosin phosphatase regulates the interaction of actin and myosin downstream of the guanosine triphosphatase Rho. The small guanosine triphosphatase Rho is implicated in myosin light chain (MLC) phosphorylation, which results in contraction of smooth muscle and interaction of actin and myosin in nonmuscle cells. The guanosine triphosphate (GTP)-bound, active form of RhoA (GTP.RhoA) specifically interacted with the myosin-binding subunit (MBS) of myosin phosphatase, which regulates the extent of phosphorylation of MLC. Rho-associated kinase (Rho-kinase), which is activated by GTP. RhoA, phosphorylated MBS and consequently inactivated myosin phosphatase. Overexpression of RhoA or activated RhoA in NIH 3T3 cells increased phosphorylation of MBS and MLC. Thus, Rho appears to inhibit myosin phosphatase through the action of Rho-kinase. Several transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
111,809 Da
NCBI Official Full Name
protein phosphatase 1 regulatory subunit 12A
NCBI Official Synonym Full Names
protein phosphatase 1, regulatory (inhibitor) subunit 12A
NCBI Official Symbol
Ppp1r12a
NCBI Official Synonym Symbols
Mypt1; AA792106; AV099298; D10Ertd625e; 1200015F06Rik; 5730577I22Rik
NCBI Protein Information
protein phosphatase 1 regulatory subunit 12A
UniProt Protein Name
Protein phosphatase 1 regulatory subunit 12A
UniProt Gene Name
Ppp1r12a
UniProt Synonym Gene Names
Myosin phosphatase target subunit 1

Uniprot Description

Key regulator of protein phosphatase 1C (PPP1C). Mediates binding to myosin. As part of the PPP1C complex, involved in dephosphorylation of PLK1. Capable of inhibiting HIF1AN-dependent suppression of HIF1A activity ().

Research Articles on Ppp1r12a

Similar Products

Product Notes

The Ppp1r12a ppp1r12a (Catalog #AAA1420504) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 853-946. Partial. The amino acid sequence is listed below: GVSFWTQDSD ENEQERQSDT EDGSSKRETQ TDSVSRYDSS STSSSDRYDS LLGRSASYSY LEDRKPYSSR LEKDDSTDFK KLYEQILAEN EKLK. It is sometimes possible for the material contained within the vial of "Protein phosphatase 1 regulatory subunit 12A (Ppp1r12a), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.