Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PPP1R12ASample Tissue: Human NCI-H226 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human PPP1R12A Polyclonal Antibody | anti-PPP1R12A antibody

PPP1R12A Antibody - middle region

Gene Names
PPP1R12A; MBS; M130; MYPT1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
PPP1R12A; Polyclonal Antibody; PPP1R12A Antibody - middle region; anti-PPP1R12A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RRPREKRRSTGVSFWTQDSDENEQEQQSDTEEGSNKKETQTDSISRYETS
Sequence Length
1030
Applicable Applications for anti-PPP1R12A antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PPP1R12A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PPP1R12ASample Tissue: Human NCI-H226 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PPP1R12ASample Tissue: Human NCI-H226 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-PPP1R12A antibody
Myosin phosphatase target subunit 1, which is also called the myosin-binding subunit of myosin phosphatase, is one of the subunits of myosin phosphatase. Myosin phosphatase regulates the interaction of actin and myosin downstream of the guanosine triphosphatase Rho. The small guanosine triphosphatase Rho is implicated in myosin light chain (MLC) phosphorylation, which results in contraction of smooth muscle and interaction of actin and myosin in nonmuscle cells. The guanosine triphosphate (GTP)-bound, active form of RhoA (GTP.RhoA) specifically interacted with the myosin-binding subunit (MBS) of myosin phosphatase, which regulates the extent of phosphorylation of MLC. Rho-associated kinase (Rho-kinase), which is activated by GTP. RhoA, phosphorylated MBS and consequently inactivated myosin phosphatase. Overexpression of RhoA or activated RhoA in NIH 3T3 cells increased phosphorylation of MBS and MLC. Thus, Rho appears to inhibit myosin phosphatase through the action of Rho-kinase. Several transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
113 kDa
NCBI Official Full Name
protein phosphatase 1 regulatory subunit 12A isoform a
NCBI Official Synonym Full Names
protein phosphatase 1 regulatory subunit 12A
NCBI Official Symbol
PPP1R12A
NCBI Official Synonym Symbols
MBS; M130; MYPT1
NCBI Protein Information
protein phosphatase 1 regulatory subunit 12A
UniProt Protein Name
Protein phosphatase 1 regulatory subunit 12A
UniProt Gene Name
PPP1R12A
UniProt Synonym Gene Names
MBS; MYPT1; Myosin phosphatase target subunit 1
UniProt Entry Name
MYPT1_HUMAN

NCBI Description

Myosin phosphatase target subunit 1, which is also called the myosin-binding subunit of myosin phosphatase, is one of the subunits of myosin phosphatase. Myosin phosphatase regulates the interaction of actin and myosin downstream of the guanosine triphosphatase Rho. The small guanosine triphosphatase Rho is implicated in myosin light chain (MLC) phosphorylation, which results in contraction of smooth muscle and interaction of actin and myosin in nonmuscle cells. The guanosine triphosphate (GTP)-bound, active form of RhoA (GTP.RhoA) specifically interacted with the myosin-binding subunit (MBS) of myosin phosphatase, which regulates the extent of phosphorylation of MLC. Rho-associated kinase (Rho-kinase), which is activated by GTP. RhoA, phosphorylated MBS and consequently inactivated myosin phosphatase. Overexpression of RhoA or activated RhoA in NIH 3T3 cells increased phosphorylation of MBS and MLC. Thus, Rho appears to inhibit myosin phosphatase through the action of Rho-kinase. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2009]

Uniprot Description

MYPT1: myosin phosphatase target subunit 1, a regulatory subunit of protein phosphatase 1. Also called the myosin-binding subunit of myosin phosphatase. Myosin phosphatase regulates the interaction of actin and myosin downstream of the guanosine triphosphatase Rho. Four splice-variant isoforms have been described.

Protein type: Protein phosphatase, regulatory subunit; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 12q15-q21

Cellular Component: kinetochore; nucleoplasm; centrosome; focal adhesion; contractile fiber; cytoplasm; actin cytoskeleton

Molecular Function: enzyme inhibitor activity; protein binding; signal transducer activity; phosphatase regulator activity; protein kinase binding

Biological Process: regulation of cell adhesion; mitosis; centrosome organization and biogenesis; regulation of nucleocytoplasmic transport; negative regulation of catalytic activity; positive regulation of transcription from RNA polymerase II promoter; mitotic cell cycle; signal transduction; G2/M transition of mitotic cell cycle; protein amino acid dephosphorylation

Research Articles on PPP1R12A

Similar Products

Product Notes

The PPP1R12A ppp1r12a (Catalog #AAA3221576) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PPP1R12A Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PPP1R12A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PPP1R12A ppp1r12a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RRPREKRRST GVSFWTQDSD ENEQEQQSDT EEGSNKKETQ TDSISRYETS. It is sometimes possible for the material contained within the vial of "PPP1R12A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.