Western Blot (WB)
(WB Suggested Anti-ZA20D1 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: Daudi cell lysateOTUD7B is supported by BioGPS gene expression data to be expressed in Daudi)
Rabbit ZA20D1 Polyclonal Antibody | anti-OTUD7B antibody
ZA20D1 antibody - middle region
Gene Names
OTUD7B; ZA20D1; CEZANNE
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
ZA20D1; Polyclonal Antibody; ZA20D1 antibody - middle region; anti-OTUD7B antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: WKGGKEEAAGDGPVSEKPPAESVGNGGSKYSQEVMQSLSILRTAMQGEGK
Sequence Length
858
Applicable Applications for anti-OTUD7B antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ZA20D1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-ZA20D1 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: Daudi cell lysateOTUD7B is supported by BioGPS gene expression data to be expressed in Daudi)
Western Blot (WB)
(WB Suggested Anti-ZA20D1 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: Daudi cell lysateOTUD7B is supported by BioGPS gene expression data to be expressed in Daudi)
Related Product Information for anti-OTUD7B antibody
This is a rabbit polyclonal antibody against ZA20D1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The ZA20D1 gene encodes an enzyme that cleaves ubiquitin from proteins. This gene has the ability to down-regulate NF-kappa B which plays a pivotal role in inflammatory processes through induction of adhesion molecules and chemokines.
Target Description: The ZA20D1 gene encodes an enzyme that cleaves ubiquitin from proteins. This gene has the ability to down-regulate NF-kappa B which plays a pivotal role in inflammatory processes through induction of adhesion molecules and chemokines.
Product Categories/Family for anti-OTUD7B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
94kDa
NCBI Official Full Name
OTU domain-containing protein 7B
NCBI Official Synonym Full Names
OTU deubiquitinase 7B
NCBI Official Symbol
OTUD7B
NCBI Official Synonym Symbols
ZA20D1; CEZANNE
NCBI Protein Information
OTU domain-containing protein 7B
UniProt Protein Name
OTU domain-containing protein 7B
Protein Family
UniProt Gene Name
OTUD7B
UniProt Synonym Gene Names
ZA20D1
UniProt Entry Name
OTU7B_HUMAN
Uniprot Description
Cezanne: cellular zinc finger anti-NF-kappaB, a negative regulator of NF-kappaB. A novel deubiquitinating enzyme that belongs to the ovarian tumor protein (OTU) superfamily.
Protein type: EC 3.4.19.12; Ubiquitin conjugating system; Protease
Chromosomal Location of Human Ortholog: 1q21.2
Cellular Component: cytoplasm; nucleus
Molecular Function: protein binding; DNA binding; zinc ion binding; ubiquitin-specific protease activity; cysteine-type peptidase activity
Biological Process: mucosal immune response; negative regulation of interleukin-8 production; negative regulation of I-kappaB kinase/NF-kappaB cascade; negative regulation of transcription from RNA polymerase II promoter; proteolysis
Research Articles on OTUD7B
Similar Products
Product Notes
The OTUD7B otud7b (Catalog #AAA3202160) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZA20D1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ZA20D1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the OTUD7B otud7b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: WKGGKEEAAG DGPVSEKPPA ESVGNGGSKY SQEVMQSLSI LRTAMQGEGK. It is sometimes possible for the material contained within the vial of "ZA20D1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
