Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human OTUD7B Monoclonal Antibody | anti-OTUD7B antibody

OTUD7B (OTU Domain-containing Protein 7B, Cellular Zinc Finger Anti-NF-kappa-B Protein, Zinc Finger A20 Domain-containing Protein 1, ZA20D1, Zinc Finger Protein Cezanne) (Biotin)

Gene Names
OTUD7B; ZA20D1; CEZANNE
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
OTUD7B; Monoclonal Antibody; OTUD7B (OTU Domain-containing Protein 7B; Cellular Zinc Finger Anti-NF-kappa-B Protein; Zinc Finger A20 Domain-containing Protein 1; ZA20D1; Zinc Finger Protein Cezanne) (Biotin); EC=3.4.19.12; anti-OTUD7B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2B4
Specificity
Recognizes human ZA20D1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-OTUD7B antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa759-859 from human ZA20D1 (NP_064590) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DSIPSLEPGSHSKDGLHRGALLPPPYRVADSYSNGYREPPEPDGWAGGLRGLPPTQTKCKQPNCSFYGHPETNNFCSCCYREELRRREREPDGELLVHRF
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to OTUD7B on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to OTUD7B on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged OTUD7B is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged OTUD7B is 0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-OTUD7B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
94kDa
NCBI Official Full Name
OTU domain-containing protein 7B
NCBI Official Synonym Full Names
OTU deubiquitinase 7B
NCBI Official Symbol
OTUD7B
NCBI Official Synonym Symbols
ZA20D1; CEZANNE
NCBI Protein Information
OTU domain-containing protein 7B
UniProt Protein Name
OTU domain-containing protein 7B
UniProt Gene Name
OTUD7B
UniProt Synonym Gene Names
ZA20D1
UniProt Entry Name
OTU7B_HUMAN

Uniprot Description

Cezanne: cellular zinc finger anti-NF-kappaB, a negative regulator of NF-kappaB. A novel deubiquitinating enzyme that belongs to the ovarian tumor protein (OTU) superfamily.

Protein type: EC 3.4.19.12; Ubiquitin conjugating system; Protease

Chromosomal Location of Human Ortholog: 1q21.2

Cellular Component: cytoplasm; nucleus

Molecular Function: protein binding; DNA binding; zinc ion binding; ubiquitin-specific protease activity; cysteine-type peptidase activity

Biological Process: mucosal immune response; negative regulation of interleukin-8 production; negative regulation of I-kappaB kinase/NF-kappaB cascade; negative regulation of transcription from RNA polymerase II promoter; proteolysis

Research Articles on OTUD7B

Similar Products

Product Notes

The OTUD7B otud7b (Catalog #AAA6145204) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The OTUD7B (OTU Domain-containing Protein 7B, Cellular Zinc Finger Anti-NF-kappa-B Protein, Zinc Finger A20 Domain-containing Protein 1, ZA20D1, Zinc Finger Protein Cezanne) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's OTUD7B can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the OTUD7B otud7b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "OTUD7B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.