Rabbit OTUD7B Polyclonal Antibody | anti-OTUD7B antibody

OTUD7B antibody - middle region

Cat. Num. AAA3202161

• Gene Names: OTUD7B; ZA20D1; CEZANNE
• Reactivity: Cow, Dog, Guinea Pig, Human, Mouse, Rat, Zebrafish
• Applications: Western Blot, Immunohistochemistry
• Purity: Affinity Purified
• Synonyms: OTUD7B; Polyclonal Antibody; OTUD7B antibody - middle region; anti-OTUD7B antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Guinea Pig, Human, Mouse, Rat, Zebrafish
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: VGTLKMGHRHQYQEEMIQRYLSDAEERFLAEQKQKEAERKIMNGGIGGGP
• Sequence Length: 843

• Applicable Applications for anti-OTUD7B antibody: Western Blot (WB), Immunohistochemistry (IHC)
• Homology: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 83%
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human OTUD7B
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-OTUD7B AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult heartObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

Immunohistochemistry (IHC)

(Rabbit Anti-OTUD7B AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult heartObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

Western Blot (WB)

(WB Suggested Anti-OTUD7B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysate)

Related Product Information for anti-OTUD7B antibody

This is a rabbit polyclonal antibody against OTUD7B. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The ZA20D1 (OTUD7B) gene encodes an enzyme that cleaves ubiquitin from proteins. This gene has the ability to down-regulate NF-kappa B which plays a pivotal role in inflammatory processes through induction of adhesion molecules and chemokines.

Product Categories/Family for anti-OTUD7B antibody

Polyclonal; Transcription Factor; E3 & Ubiquitin

NCBI and Uniprot Product Information

• NCBI GI #: 118026942
• NCBI GeneID: 56957
• NCBI Accession #: NP_064590
• NCBI GenBank Nucleotide #: NM_020205
• UniProt Accession #: Q6GQQ9
• Molecular Weight: 92kDa
• NCBI Official Full Name: OTU domain-containing protein 7B
• NCBI Official Synonym Full Names: OTU deubiquitinase 7B
• NCBI Official Symbol: OTUD7B
• NCBI Official Synonym Symbols: ZA20D1; CEZANNE
• NCBI Protein Information: OTU domain-containing protein 7B
• UniProt Protein Name: OTU domain-containing protein 7B
• Protein Family: OTU domain-containing protein
• UniProt Gene Name: OTUD7B
• UniProt Synonym Gene Names: ZA20D1
• UniProt Entry Name: OTU7B_HUMAN

Uniprot Description

Cezanne: cellular zinc finger anti-NF-kappaB, a negative regulator of NF-kappaB. A novel deubiquitinating enzyme that belongs to the ovarian tumor protein (OTU) superfamily.

Protein type: EC 3.4.19.12; Ubiquitin conjugating system; Protease

Chromosomal Location of Human Ortholog: 1q21.2

Cellular Component: cytoplasm; nucleus

Molecular Function: protein binding; DNA binding; zinc ion binding; ubiquitin-specific protease activity; cysteine-type peptidase activity

Biological Process: mucosal immune response; negative regulation of interleukin-8 production; negative regulation of I-kappaB kinase/NF-kappaB cascade; negative regulation of transcription from RNA polymerase II promoter; proteolysis