Western Blot (WB)
(WB Suggested Anti-WHAMM AntibodyTitration: 1.0 ug/mlPositive Control: Placenta)
Rabbit WHAMM Polyclonal Antibody | anti-WHAMM antibody
WHAMM Antibody - C-terminal region
Gene Names
WHAMM; WHDC1; WHAMM1
Reactivity
Dog, Horse, Human, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
WHAMM; Polyclonal Antibody; WHAMM Antibody - C-terminal region; anti-WHAMM antibody
Host
Rabbit
Reactivity
Dog, Horse, Human, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SEAGNVKSPKCQNCHGNIPVQVFVPVGDQTHSKSSEELSLPPPPPPPPPP
Sequence Length
809
Applicable Applications for anti-WHAMM antibody
Western Blot (WB)
Homology
Dog: 86%; Horse: 93%; Human: 100%; Pig: 86%; Rat: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human WHAMM
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-WHAMM AntibodyTitration: 1.0 ug/mlPositive Control: Placenta)
Western Blot (WB)
(WB Suggested Anti-WHAMM AntibodyTitration: 1.0 ug/mlPositive Control: Placenta)
Related Product Information for anti-WHAMM antibody
This is a rabbit polyclonal antibody against WHAMM. It was validated on Western Blot
Target Description: WHAMM acts as a nucleation-promoting factor (NPF) that stimulates Arp2/3-mediated actin polymerization both at the Golgi apparatus and along tubular membranes. WHAMM is involved as a regulator of Golgi positioning and morphology. WHAMM participates in vesicle transport between the reticulum endoplasmic and the Golgi complex.
Target Description: WHAMM acts as a nucleation-promoting factor (NPF) that stimulates Arp2/3-mediated actin polymerization both at the Golgi apparatus and along tubular membranes. WHAMM is involved as a regulator of Golgi positioning and morphology. WHAMM participates in vesicle transport between the reticulum endoplasmic and the Golgi complex.
Product Categories/Family for anti-WHAMM antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
91kDa
NCBI Official Full Name
WASP homolog-associated protein with actin, membranes and microtubules
NCBI Official Synonym Full Names
WASP homolog associated with actin, golgi membranes and microtubules
NCBI Official Symbol
WHAMM
NCBI Official Synonym Symbols
WHDC1; WHAMM1
NCBI Protein Information
WASP homolog-associated protein with actin, membranes and microtubules
UniProt Protein Name
WASP homolog-associated protein with actin, membranes and microtubules
Protein Family
UniProt Gene Name
WHAMM
UniProt Synonym Gene Names
KIAA1971; WHDC1; WH2 domain-containing protein 1
UniProt Entry Name
WHAMM_HUMAN
NCBI Description
This gene encodes a protein that plays a role in actin nucleation, Golgi membrane association and microtubule binding. The encoded protein is a nucleation-promoting factor that regulates the Actin-related protein 2/3 complex. The activated complex initiates growth of new actin filaments by binding to existing actin filaments. The encoded protein also functions in regulation of transport from the endoplasmic reticulum to the Golgi complex and in maintenance of the Golgi complex near the centrosome. Four pseudogenes of this gene are present on the same arm of chromosome 15 as this gene. [provided by RefSeq, Aug 2013]
Research Articles on WHAMM
Similar Products
Product Notes
The WHAMM whamm (Catalog #AAA3217059) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The WHAMM Antibody - C-terminal region reacts with Dog, Horse, Human, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's WHAMM can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the WHAMM whamm for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SEAGNVKSPK CQNCHGNIPV QVFVPVGDQT HSKSSEELSL PPPPPPPPPP. It is sometimes possible for the material contained within the vial of "WHAMM, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
