Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-AHSA1 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole CellAHSA1 is supported by BioGPS gene expression data to be expressed in MCF7)

Rabbit AHSA1 Polyclonal Antibody | anti-AHSA1 antibody

AHSA1 Antibody - C-terminal region

Gene Names
AHSA1; p38; AHA1; hAha1; C14orf3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
AHSA1; Polyclonal Antibody; AHSA1 Antibody - C-terminal region; anti-AHSA1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VMKWRFKSWPEGHFATITLTFIDKNGETELCMEGRGIPAPEEERTRQGWQ
Sequence Length
338
Applicable Applications for anti-AHSA1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human AHSA1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-AHSA1 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole CellAHSA1 is supported by BioGPS gene expression data to be expressed in MCF7)

Western Blot (WB) (WB Suggested Anti-AHSA1 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole CellAHSA1 is supported by BioGPS gene expression data to be expressed in MCF7)
Related Product Information for anti-AHSA1 antibody
This is a rabbit polyclonal antibody against AHSA1. It was validated on Western Blot

Target Description: AHSA1 is a cochaperone that stimulates HSP90 ATPase activity. AHSA1 may affect a step in the endoplasmic reticulum to Golgi trafficking.
Product Categories/Family for anti-AHSA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
activator of 90 kDa heat shock protein ATPase homolog 1 isoform 1
NCBI Official Synonym Full Names
activator of HSP90 ATPase activity 1
NCBI Official Symbol
AHSA1
NCBI Official Synonym Symbols
p38; AHA1; hAha1; C14orf3
NCBI Protein Information
activator of 90 kDa heat shock protein ATPase homolog 1
UniProt Protein Name
Activator of 90 kDa heat shock protein ATPase homolog 1
UniProt Gene Name
AHSA1
UniProt Synonym Gene Names
C14orf3; AHA1
UniProt Entry Name
AHSA1_HUMAN

Uniprot Description

AHSA1: Cochaperone that stimulates HSP90 ATPase activity. May affect a step in the endoplasmic reticulum to Golgi trafficking. Belongs to the AHA1 family.

Protein type: Chaperone

Chromosomal Location of Human Ortholog: 14q24

Cellular Component: endoplasmic reticulum; cytoplasm; cytosol

Molecular Function: ATPase activator activity; protein binding; chaperone binding

Biological Process: positive regulation of ATPase activity; response to stress

Research Articles on AHSA1

Similar Products

Product Notes

The AHSA1 ahsa1 (Catalog #AAA3216976) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AHSA1 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's AHSA1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AHSA1 ahsa1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VMKWRFKSWP EGHFATITLT FIDKNGETEL CMEGRGIPAP EEERTRQGWQ. It is sometimes possible for the material contained within the vial of "AHSA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.