Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-VNN2 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal kidney)

Rabbit VNN2 Polyclonal Antibody | anti-VNN2 antibody

VNN2 antibody - C-terminal region

Gene Names
VNN2; FOAP-4; GPI-80
Reactivity
Cow, Dog, Horse, Human, Pig, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
VNN2; Polyclonal Antibody; VNN2 antibody - C-terminal region; anti-VNN2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Pig, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FRGFISRDGFNFTELFENAGNLTVCQKELCCHLSYRMLQKEENEVYVLGA
Sequence Length
520
Applicable Applications for anti-VNN2 antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 89%; Horse: 86%; Human: 100%; Pig: 93%; Sheep: 86%; Zebrafish: 75%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-VNN2 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal kidney)

Western Blot (WB) (WB Suggested Anti-VNN2 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal kidney)
Related Product Information for anti-VNN2 antibody
This is a rabbit polyclonal antibody against VNN2. It was validated on Western Blot

Target Description: This gene product is a member of the Vanin family of proteins that share extensive sequence similarity with each other, and also with biotinidase. The family includes secreted and membrane-associated proteins, a few of which have been reported to participate in hematopoietic cell trafficking. No biotinidase activity has been demonstrated for any of the vanin proteins, however, they possess pantetheinase activity, which may play a role in oxidative-stress response. The encoded protein is a GPI-anchored cell surface molecule that plays a role in transendothelial migration of neutrophils. This gene lies in close proximity to, and in same transcriptional orientation as two other vanin genes on chromosome 6q23-q24. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Product Categories/Family for anti-VNN2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57kDa
NCBI Official Full Name
vascular non-inflammatory molecule 2 isoform 1
NCBI Official Synonym Full Names
vanin 2
NCBI Official Symbol
VNN2
NCBI Official Synonym Symbols
FOAP-4; GPI-80
NCBI Protein Information
vascular non-inflammatory molecule 2
UniProt Protein Name
Vascular non-inflammatory molecule 2
UniProt Gene Name
VNN2
UniProt Synonym Gene Names
Vanin-2
UniProt Entry Name
VNN2_HUMAN

NCBI Description

This gene product is a member of the Vanin family of proteins that share extensive sequence similarity with each other, and also with biotinidase. The family includes secreted and membrane-associated proteins, a few of which have been reported to participate in hematopoietic cell trafficking. No biotinidase activity has been demonstrated for any of the vanin proteins, however, they possess pantetheinase activity, which may play a role in oxidative-stress response. The encoded protein is a GPI-anchored cell surface molecule that plays a role in transendothelial migration of neutrophils. This gene lies in close proximity to, and in same transcriptional orientation as two other vanin genes on chromosome 6q23-q24. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, May 2011]

Research Articles on VNN2

Similar Products

Product Notes

The VNN2 vnn2 (Catalog #AAA3215357) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The VNN2 antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Pig, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's VNN2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the VNN2 vnn2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FRGFISRDGF NFTELFENAG NLTVCQKELC CHLSYRMLQK EENEVYVLGA. It is sometimes possible for the material contained within the vial of "VNN2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.