Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-VGF Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: THP-1 cell lysate)

Rabbit VGF Polyclonal Antibody | anti-VGF antibody

VGF antibody - middle region

Gene Names
VGF; SCG7; SgVII
Reactivity
Dog, Horse, Human, Mouse, Pig, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
VGF; Polyclonal Antibody; VGF antibody - middle region; anti-VGF antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Horse, Human, Mouse, Pig, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VRSPQPPPPAPAPARDELPDWNEVLPPWDREEDEVYPPGPYHPFPNYIRP
Sequence Length
615
Applicable Applications for anti-VGF antibody
Western Blot (WB)
Homology
Dog: 91%; Horse: 85%; Human: 100%; Mouse: 86%; Pig: 85%; Rat: 91%; Yeast: 92%; Zebrafish: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human VGF
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-VGF Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: THP-1 cell lysate)

Western Blot (WB) (WB Suggested Anti-VGF Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: THP-1 cell lysate)
Related Product Information for anti-VGF antibody
This is a rabbit polyclonal antibody against VGF. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: VGF is specifically expressed in a subpopulation of neuroendocrine cells, and is upregulated by nerve growth factor. It also shares similarities with the secretogranin/chromogranin family, however, its exact function is not known. This gene is specifically expressed in a subpopulation of neuroendocrine cells, and is upregulated by nerve growth factor. The structural organization of this gene is similar to that of the rat gene, and both the translated and the untranslated regions show a high degree of sequence similarity to the rat gene. The encoded secretory protein also shares similarities with the secretogranin/chromogranin family, however, its exact function is not known.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
65kDa
NCBI Official Full Name
neurosecretory protein VGF
NCBI Official Synonym Full Names
VGF nerve growth factor inducible
NCBI Official Symbol
VGF
NCBI Official Synonym Symbols
SCG7; SgVII
NCBI Protein Information
neurosecretory protein VGF
UniProt Protein Name
Neurosecretory protein VGF
Protein Family
UniProt Gene Name
VGF
UniProt Synonym Gene Names
NERP-1; NERP-2
UniProt Entry Name
VGF_HUMAN

NCBI Description

This gene is specifically expressed in a subpopulation of neuroendocrine cells, and is upregulated by nerve growth factor. The structural organization of this gene is similar to that of the rat gene, and both the translated and the untranslated regions show a high degree of sequence similarity to the rat gene. The encoded secretory protein also shares similarities with the secretogranin/chromogranin family, however, its exact function is not known. [provided by RefSeq, Jul 2008]

Uniprot Description

VGF: May be involved in the regulation of cell-cell interactions or in synatogenesis during the maturation of the nervous system.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 7q22.1

Cellular Component: extracellular space; transport vesicle; cytoplasmic vesicle

Molecular Function: neuropeptide hormone activity; growth factor activity

Biological Process: response to dietary excess; generation of precursor metabolites and energy; response to cAMP; ovarian follicle development; sexual reproduction; insulin secretion; defense response to bacterium; response to cold; glucose homeostasis; response to insulin stimulus

Research Articles on VGF

Similar Products

Product Notes

The VGF vgf (Catalog #AAA3206210) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The VGF antibody - middle region reacts with Dog, Horse, Human, Mouse, Pig, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's VGF can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the VGF vgf for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VRSPQPPPPA PAPARDELPD WNEVLPPWDR EEDEVYPPGP YHPFPNYIRP. It is sometimes possible for the material contained within the vial of "VGF, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.