UPF3B/RENT3B Polyclonal Antibody | anti-UPF3B/RENT3B antibody

Anti-UPF3B/RENT3B Antibody

Cat. Num. AAA178132

• Gene Names: UPF3B; MRX62; UPF3X; HUPF3B; MRXS14; RENT3B; UPF3BP1; UPF3BP2; UPF3BP3; Upf3p-X
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry
• Purity: Immunogen Affinity Purified
• Synonyms: UPF3B/RENT3B; Polyclonal Antibody; Anti-UPF3B/RENT3B Antibody; Regulator of nonsense transcripts 3B; HUPF3B; hUpf3p X; MRXS14; Nonsense mRNA reducing factor 3B; RENT3B; Up-frameshift suppressor 3 homolog B; Up-frameshift suppressor 3 homolog on chromosome X; UPF3 regulator of nonsense transcripts homolog B (yeast); UPF3 regulator of nonsense transcripts homolog B; UPF3B; UPF3X; anti-UPF3B/RENT3B antibody

• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 470

• Applicable Applications for anti-UPF3B/RENT3B antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin
• Application Notes: Western Blot Concentration: 0.1-0.5ug/ml; Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human UPF3B /RENT3B (416-452aa SEKTEKKEEVVKRDRIRNKDRPAMQLYQPGARSRNRL).
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- UPF3B/RENT3B Picoband antibody, MBS178132, Western blottingAll lanes: Anti UPF3B/RENT3B (MBS178132) at 0.5ug/mlLane 1: Rat Cardiac Muscle Tissue Lysate at 50ugLane 2: Rat Brain Tissue Lysate at 50ugLane 3: HELA Whole Cell Lysate at 40ugLane 4: 22RV1 Whole Cell Lysate at 40ugLane 5: U87 Whole Cell Lysate at 40ugLane 6: JURKAT Whole Cell Lysate at 40ugPredicted bind size: 58KDObserved bind size: 58KD )

Immunohistochemistry (IHC)

(Anti- UPF3B/RENT3B Picoband antibody, MBS178132, IHC(P)IHC(P): Mouse Testis Tissue )

Immunohistochemistry (IHC)

(Anti- UPF3B/RENT3B Picoband antibody, MBS178132, IHC(P)IHC(P): Rat Testis Tissue )

Immunohistochemistry (IHC)

(Anti- UPF3B/RENT3B Picoband antibody, MBS178132, IHC(P)IHC(P): Human Placenta Tissue )

Related Product Information for anti-UPF3B/RENT3B antibody

Description: Rabbit IgG polyclonal antibody for Regulator of nonsense transcripts 3B(UPF3B) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Regulator of nonsense transcripts 3B is a protein that in humans is encoded by the UPF3B gene. This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. The encoded protein is one of two functional homologs to yeast Upf3p. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein binds to the mRNA and remains bound after nuclear export, acting as a nucleocytoplasmic shuttling protein. It forms with Y14 a complex that binds specifically 20 nt upstream of exon-exon junctions. This gene is located on the long arm of chromosome X. Two splice variants encoding different isoforms have been found for this gene.

References

1. "Entrez Gene: UPF3B UPF3 regulator of nonsense transcripts homolog B (yeast)". 2. Lykke-Andersen J, Shu MD, Steitz JA (Feb 2001). "Human Upf proteins target an mRNA for nonsense-mediated decay when bound downstream of a termination codon". Cell 103 (7): 1121-31. 3. Serin G, Gersappe A, Black JD, Aronoff R, Maquat LE (Jan 2001). "Identification and characterization of human orthologues to Saccharomyces cerevisiae Upf2 protein and Upf3 protein (Caenorhabditis elegans SMG-4)". Mol Cell Biol 21 (1): 209-23.

NCBI and Uniprot Product Information

• NCBI GI #: 12711674
• NCBI GeneID: 65109
• NCBI Accession #: NP_075386.1
• NCBI GenBank Nucleotide #: NM_023010.3
• UniProt Accession #: Q9BZI7; Q0VAK8; Q9H1J0; D3DWI3; D3DWI4
• Molecular Weight: 56,213 Da
• NCBI Official Full Name: regulator of nonsense transcripts 3B isoform 2
• NCBI Official Synonym Full Names: UPF3 regulator of nonsense transcripts homolog B (yeast)
• NCBI Official Symbol: UPF3B
• NCBI Official Synonym Symbols: MRX62; UPF3X; HUPF3B; MRXS14; RENT3B; UPF3BP1; UPF3BP2; UPF3BP3; Upf3p-X
• NCBI Protein Information: regulator of nonsense transcripts 3B
• UniProt Protein Name: Regulator of nonsense transcripts 3B
• UniProt Gene Name: UPF3B
• UniProt Synonym Gene Names: RENT3B; UPF3X; hUpf3B; hUpf3p-X
• UniProt Entry Name: REN3B_HUMAN

NCBI Description

This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. The encoded protein is one of two functional homologs to yeast Upf3p. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein binds to the mRNA and remains bound after nuclear export, acting as a nucleocytoplasmic shuttling protein. It forms with Y14 a complex that binds specifically 20 nt upstream of exon-exon junctions. This gene is located on the long arm of chromosome X. Two splice variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

UPF3B: Involved in nonsense-mediated decay (NMD) of mRNAs containing premature stop codons by associating with the nuclear exon junction complex (EJC) and serving as link between the EJC core and NMD machinery. Recruits UPF2 at the cytoplasmic side of the nuclear envelope and the subsequent formation of an UPF1-UPF2- UPF3 surveillance complex (including UPF1 bound to release factors at the stalled ribosome) is believed to activate NMD. In cooperation with UPF2 stimulates both ATPase and RNA helicase activities of UPF1. Binds spliced mRNA upstream of exon-exon junctions. In vitro, stimulates translation; the function is indepenedent of association with UPF2 and components of the EJC core. Defects in UPF3B are the cause of mental retardation syndromic X-linked type 14 (MRXS14). Mental retardation is characterized by significantly below average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. MRXS14 patients manifest mental retardation associated with other variable signs such as autistic features, slender build, poor musculature, long, thin face, high-arched palate, high nasal bridge, and pectus deformities. Belongs to the RENT3 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: RNA-binding; RNA splicing

Chromosomal Location of Human Ortholog: Xq24

Cellular Component: cytoplasm; cytosol; microtubule organizing center; nucleolus; nucleoplasm; nucleus

Molecular Function: mRNA binding; nucleocytoplasmic transporter activity; nucleotide binding; protein binding

Biological Process: mRNA 3'-end processing; mRNA catabolic process, nonsense-mediated decay; mRNA export from nucleus; nuclear mRNA splicing, via spliceosome; positive regulation of translation; RNA export from nucleus; termination of RNA polymerase II transcription

Disease: Mental Retardation, X-linked, Syndromic 14