Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-UHRF1 AntibodyPositive Control: Lane 1: 60ug HCT116 lysate Lane 2: 60ug HCT116 lysate + siRNAPrimary Antibody Dilution : 1:1000Secondary Antibody : Anti rabbit-HRPSecondry Antibody Dilution : 1:5,000Submitted by: Chinweike Ukomadu, Brigham and Women's Hospital, Boston)

Rabbit UHRF1 Polyclonal Antibody | anti-UHRF1 antibody

UHRF1 antibody - N-terminal region

Gene Names
UHRF1; Np95; hNP95; ICBP90; RNF106; TDRD22; hUHRF1; huNp95
Reactivity
Guinea Pig, Human, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
UHRF1; Polyclonal Antibody; UHRF1 antibody - N-terminal region; anti-UHRF1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Guinea Pig, Human, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MGVFAVPPLSADTMWIQVRTMDGRQTHTVDSLSRLTKVEELRRKIQELFH
Sequence Length
806
Applicable Applications for anti-UHRF1 antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 79%; Guinea Pig: 86%; Human: 100%; Mouse: 79%; Rat: 86%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human UHRF1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-UHRF1 AntibodyPositive Control: Lane 1: 60ug HCT116 lysate Lane 2: 60ug HCT116 lysate + siRNAPrimary Antibody Dilution : 1:1000Secondary Antibody : Anti rabbit-HRPSecondry Antibody Dilution : 1:5,000Submitted by: Chinweike Ukomadu, Brigham and Women's Hospital, Boston)

Western Blot (WB) (WB Suggested Anti-UHRF1 AntibodyPositive Control: Lane 1: 60ug HCT116 lysate Lane 2: 60ug HCT116 lysate + siRNAPrimary Antibody Dilution : 1:1000Secondary Antibody : Anti rabbit-HRPSecondry Antibody Dilution : 1:5,000Submitted by: Chinweike Ukomadu, Brigham and Women's Hospital, Boston)

Western Blot (WB)

(WB Suggested Anti-UHRF1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Stomach)

Western Blot (WB) (WB Suggested Anti-UHRF1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Stomach)
Related Product Information for anti-UHRF1 antibody
This is a rabbit polyclonal antibody against UHRF1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene encodes a member of a subfamily of RING-finger type E3 ubiquitin ligases. The protein binds to specific DNA sequences, and recruits a histone deacetylase to regulate gene expression. Its expression peaks at late G1 phase and continues during G2

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
91kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase UHRF1 isoform 2
NCBI Official Synonym Full Names
ubiquitin like with PHD and ring finger domains 1
NCBI Official Symbol
UHRF1
NCBI Official Synonym Symbols
Np95; hNP95; ICBP90; RNF106; TDRD22; hUHRF1; huNp95
NCBI Protein Information
E3 ubiquitin-protein ligase UHRF1
Protein Family

NCBI Description

This gene encodes a member of a subfamily of RING-finger type E3 ubiquitin ligases. The protein binds to specific DNA sequences, and recruits a histone deacetylase to regulate gene expression. Its expression peaks at late G1 phase and continues during G2 and M phases of the cell cycle. It plays a major role in the G1/S transition by regulating topoisomerase IIalpha and retinoblastoma gene expression, and functions in the p53-dependent DNA damage checkpoint. It is regarded as a hub protein for the integration of epigenetic information. This gene is up-regulated in various cancers, and it is therefore considered to be a therapeutic target. Multiple transcript variants encoding different isoforms have been found for this gene. A related pseudogene exists on chromosome 12. [provided by RefSeq, Feb 2014]

Research Articles on UHRF1

Similar Products

Product Notes

The UHRF1 (Catalog #AAA3204403) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UHRF1 antibody - N-terminal region reacts with Guinea Pig, Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's UHRF1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the UHRF1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MGVFAVPPLS ADTMWIQVRT MDGRQTHTVD SLSRLTKVEE LRRKIQELFH. It is sometimes possible for the material contained within the vial of "UHRF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.