Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (UGT1A7 antibody (MBS5303032) used at 1 ug/ml to detect target protein.)

Rabbit UGT1A7 Polyclonal Antibody | anti-UGT1A7 antibody

UGT1A7 antibody

Applications
Western Blot
Purity
Affinity purified
Synonyms
UGT1A7; Polyclonal Antibody; UGT1A7 antibody; Polyclonal UGT1A7; Anti-UGT1A7; UGT1G; UGTA7-1; Udp Glucuronosyltransferase 1 Family Polypeptide A7; UDPGT; UGTA7 1; anti-UGT1A7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
UGT1A7 antibody was raised against the N terminal of UGT1A7
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UGT1A7 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Applicable Applications for anti-UGT1A7 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
UGT1A7 is an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme encoded by this gene has moderate glucuronidase activity with phenols.
Cross-Reactivity
Human
Immunogen
UGT1A7 antibody was raised using the N terminal of UGT1A7 corresponding to a region with amino acids VKTYSTSYTLEDQDREFMVFADARWTAPLRSAFSLLTSSSNGIFDLFFSN
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(UGT1A7 antibody (MBS5303032) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (UGT1A7 antibody (MBS5303032) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-UGT1A7 antibody
Rabbit polyclonal UGT1A7 antibody raised against the N terminal of UGT1A7
Product Categories/Family for anti-UGT1A7 antibody

Similar Products

Product Notes

The UGT1A7 (Catalog #AAA5303032) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's UGT1A7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the UGT1A7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "UGT1A7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.