Rabbit ApoA-IV Polyclonal Antibody | anti-ApoA-IV antibody

ApoA-IV antibody

Cat. Num. AAA5301428

• Applications: Western Blot
• Purity: Affinity purified
• Synonyms: ApoA-IV; Polyclonal Antibody; ApoA-IV antibody; Polyclonal ApoA-IV; Anti-ApoA-IV; Apo AIV antibdoy; MGC142156; MGC142154; Apolipoprotein A lV; Apolipoprotein A-Iv; ApoA4; anti-ApoA-IV antibody

• Host: Rabbit
• Clonality: Polyclonal
• Specificity: ApoA-IV antibody was raised against the C terminal of APOA4
• Purity/Purification: Affinity purified
• Form/Format: Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of APOA4 antibody in PBS
• Concentration: 1 mg/ml (varies by lot)
• Sequence Length: 396

• Applicable Applications for anti-ApoA-IV antibody: Western Blot (WB)
• Application Notes: WB: 1 ug/ml
• Biological Significance: The gene encoding APOA4 protein contains 3 exons separated by two introns. A sequence polymorphism has been identified in the 3'UTR of the third exon. The primary translation product is a 396-residue preprotein which after proteolytic processing is secreted its primary site of synthesis, the intestine, in association with chylomicron particles. Although its precise function is not known, apo A-IV is a potent activator of lecithin-cholesterol acyltransferase in vitro.
• Cross-Reactivity: Human
• Immunogen: ApoA-IV antibody was raised using the C terminal of APOA4 corresponding to a region with amino acids RQKLGPHAGDVEGHLSFLEKDLRDKVNSFFSTFKEKESQDKTLSLPELEQ
• Preparation and Storage: Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(ApoA-IV antibody (MBS5301428) used at 1 ug/ml to detect target protein.)

Related Product Information for anti-ApoA-IV antibody

Rabbit polyclonal ApoA-IV antibody raised against the C terminal of APOA4

Product Categories/Family for anti-ApoA-IV antibody

Cell Biology; Purified Polyclonal Antibodies

NCBI and Uniprot Product Information

• NCBI GI #: 71773110
• NCBI GeneID: 337
• NCBI Accession #: NP_000473.2
• NCBI GenBank Nucleotide #: NM_000482.3
• Molecular Weight: 43 kDa (MW of target protein)
• NCBI Official Full Name: apolipoprotein A-IV
• NCBI Official Synonym Full Names: apolipoprotein A-IV
• NCBI Official Symbol: APOA4
• NCBI Protein Information: apolipoprotein A-IV
• UniProt Protein Name: Apolipoprotein A-IV
• UniProt Gene Name: APOA4
• UniProt Synonym Gene Names: Apo-AIV; ApoA-IV
• UniProt Entry Name: APOA4_HUMAN

NCBI Description

Apoliprotein (apo) A-IV gene contains 3 exons separated by two introns. A sequence polymorphism has been identified in the 3'UTR of the third exon. The primary translation product is a 396-residue preprotein which after proteolytic processing is secreted its primary site of synthesis, the intestine, in association with chylomicron particles. Although its precise function is not known, apo A-IV is a potent activator of lecithin-cholesterol acyltransferase in vitro. [provided by RefSeq, Jul 2008]

Uniprot Description

APOA4: May have a role in chylomicrons and VLDL secretion and catabolism. Required for efficient activation of lipoprotein lipase by ApoC-II; potent activator of LCAT. Apoa-IV is a major component of HDL and chylomicrons. Synthesized primarily in the intestine and secreted in plasma. Belongs to the apolipoprotein A1/A4/E family.

Protein type: Endoplasmic reticulum; Lipid-binding; Secreted; Cell adhesion; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 11q23

Cellular Component: extracellular space; chylomicron; cell surface; endoplasmic reticulum lumen; early endosome; extracellular region; cytosol

Molecular Function: lipid transporter activity; antioxidant activity; protein binding; protein homodimerization activity; copper ion binding; cholesterol transporter activity; cholesterol binding; phosphatidylcholine binding; lipid binding

Biological Process: multicellular organismal lipid catabolic process; phototransduction, visible light; cholesterol metabolic process; positive regulation of fatty acid biosynthetic process; removal of superoxide radicals; protein-lipid complex assembly; neurite regeneration; lipid homeostasis; lipoprotein metabolic process; cholesterol efflux; lipid transport; cholesterol biosynthetic process; phosphatidylcholine metabolic process; leukocyte adhesion; cholesterol homeostasis; reverse cholesterol transport; innate immune response in mucosa; phospholipid efflux; regulation of cholesterol absorption; response to lipid hydroperoxide; hydrogen peroxide catabolic process; positive regulation of lipoprotein lipase activity; regulation of cholesterol transport; retinoid metabolic process