Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (PANK4 antibody (MBS839437) used at 1 ug/ml to detect target protein.)

Rabbit PANK4 Polyclonal Antibody | anti-PANK4 antibody

PANK4 antibody

Applications
Western Blot
Purity
Affinity purified
Synonyms
PANK4; Polyclonal Antibody; PANK4 antibody; Polyclonal PANK4; Anti-PANK4; PANK 4; PANK-4; FLJ10782; Pantothenate Kinase 4; DKFZp547M242; anti-PANK4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
PANK4 antibody was raised against the N terminal of PANK4
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PANK4 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
781
Applicable Applications for anti-PANK4 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
This gene encodes a protein belonging to the pantothenate kinase family. Pantothenate kinase is a key regulatory enzyme in the biosynthesis of coenzyme A (CoA) in bacteria and mammalian cells.
Cross-Reactivity
Human
Immunogen
PANK4 antibody was raised using the N terminal of PANK4 corresponding to a region with amino acids MAECGASGSGSSGDSLDKSITLPPDEIFRNLENAKRFAIDIGGSLTKLAY
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(PANK4 antibody (MBS839437) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (PANK4 antibody (MBS839437) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-PANK4 antibody
Rabbit polyclonal PANK4 antibody raised against the N terminal of PANK4
Product Categories/Family for anti-PANK4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
86 kDa (MW of target protein)
NCBI Official Full Name
pantothenate kinase 4
NCBI Official Synonym Full Names
pantothenate kinase 4
NCBI Official Symbol
PANK4
NCBI Protein Information
pantothenate kinase 4
UniProt Protein Name
Pantothenate kinase 4
Protein Family
UniProt Gene Name
PANK4
UniProt Synonym Gene Names
hPanK4
UniProt Entry Name
PANK4_HUMAN

NCBI Description

This gene encodes a protein belonging to the pantothenate kinase family. Pantothenate kinase is a key regulatory enzyme in the biosynthesis of coenzyme A (CoA) in bacteria and mammalian cells. It catalyzes the first committed step in the universal biosynthetic pathway leading to CoA and is itself subject to regulation through feedback inhibition by CoA. This family member is most abundant in muscle but is expressed in all tissues. [provided by RefSeq, Jul 2008]

Uniprot Description

PANK4: a pantothenate kinase that catalyzes the first committed step in the biosynthesis of coenzyme A, an essential cofactor in cellular metabolism. PANK4 is ubiquitously expressed but is enriched in muscle. Plays a role in the physiological regulation of the intracellular CoA concentration. Regulated by feedback inhibition by CoA and its thioesters. Interacts with M2-type pyruvate kinase (PKM2) and may modulate glucose metabolism through regulating the activity of PKM2. Expression is up-regulated by high glucose concentrations.

Protein type: Cofactor and Vitamin Metabolism - pantothenate and CoA biosynthesis; EC 2.7.1.33; Kinase, other

Chromosomal Location of Human Ortholog: 1p36.32

Cellular Component: cytoplasm

Molecular Function: pantothenate kinase activity; ATP binding

Biological Process: coenzyme A biosynthetic process; phosphorylation

Research Articles on PANK4

Similar Products

Product Notes

The PANK4 pank4 (Catalog #AAA839437) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PANK4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the PANK4 pank4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PANK4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.