Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (MS4A4A antibody (MBS5300196) used at 1 ug/ml to detect target protein.)

Rabbit MS4A4A Polyclonal Antibody | anti-MS4A4A antibody

MS4A4A antibody

Gene Names
MS4A4A; MS4A4; MS4A7; 4SPAN1; CD20L1; CD20-L1; HDCME31P
Applications
Western Blot
Purity
Affinity purified
Synonyms
MS4A4A; Polyclonal Antibody; MS4A4A antibody; Polyclonal MS4A4A; Anti-MS4A4A; MS4A4; MSAA-4; CD20-L1; 4SPAN1; CD20L1; MS4A7; Membrane-Spanning 4-Domains Subfamily A Member 4; MSAA 4; MGC22311; HDCME31P; anti-MS4A4A antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
MS4A4A antibody was raised against the N terminal of MS4A4A
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MS4A4A antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
186
Applicable Applications for anti-MS4A4A antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
MS4A4A is a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues.
Cross-Reactivity
Human
Immunogen
MS4A4A antibody was raised using the N terminal of MS4A4A corresponding to a region with amino acids MHQTYSRHCRPEESTFSAAMTTMQGMEQAMPGAGPGVPQLGNMAVIHSHL
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(MS4A4A antibody (MBS5300196) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (MS4A4A antibody (MBS5300196) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-MS4A4A antibody
Rabbit polyclonal MS4A4A antibody raised against the N terminal of MS4A4A
Product Categories/Family for anti-MS4A4A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
26 kDa (MW of target protein)
NCBI Official Full Name
membrane-spanning 4-domains subfamily A member 4A isoform 3
NCBI Official Synonym Full Names
membrane-spanning 4-domains, subfamily A, member 4A
NCBI Official Symbol
MS4A4A
NCBI Official Synonym Symbols
MS4A4; MS4A7; 4SPAN1; CD20L1; CD20-L1; HDCME31P
NCBI Protein Information
membrane-spanning 4-domains subfamily A member 4A
UniProt Protein Name
Membrane-spanning 4-domains subfamily A member 4A
UniProt Gene Name
MS4A4A
UniProt Synonym Gene Names
4SPAN1; CD20L1; MS4A4
UniProt Entry Name
M4A4A_HUMAN

NCBI Description

This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features, similar intron/exon splice boundaries, and display unique expression patterns in hematopoietic cells and nonlymphoid tissues. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011]

Uniprot Description

MS4A4A: May be involved in signal transduction as a component of a multimeric receptor complex. Belongs to the MS4A family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 11q12

Cellular Component: integral to membrane

Research Articles on MS4A4A

Similar Products

Product Notes

The MS4A4A ms4a4a (Catalog #AAA5300196) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's MS4A4A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the MS4A4A ms4a4a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MS4A4A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.