Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Myosin Ic antibody (MBS5300641) used at 1 ug/ml to detect target protein.)

Rabbit Myosin Ic Polyclonal Antibody | anti-MYO1C antibody

Myosin Ic antibody

Gene Names
MYO1C; NMI; MMIb; myr2; MMI-beta
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
Myosin Ic; Polyclonal Antibody; Myosin Ic antibody; Polyclonal Myosin Ic; Anti-Myosin Ic; MMIb; MMI-beta; myr2; NMI; MYO1C; FLJ23903; anti-MYO1C antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
Myosin Ic antibody was raised against the N terminal of MYO1C
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MYO1C antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
1028
Applicable Applications for anti-MYO1C antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
This gene encodes a member of the unconventional myosin protein family, which are actin-based molecular motors. The protein is found in the cytoplasm, and one isoform with a unique N-terminus is also found in the nucleus.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
Myosin Ic antibody was raised using the N terminal of MYO1C corresponding to a region with amino acids NPVLEAFGNAKTLRNDNSSRFGKYMDVQFDFKGAPVGGHILSYLLEKSRV
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(Myosin Ic antibody (MBS5300641) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (Myosin Ic antibody (MBS5300641) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-MYO1C antibody
Rabbit polyclonal Myosin Ic antibody raised against the N terminal of MYO1C
Product Categories/Family for anti-MYO1C antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
113 kDa (MW of target protein)
NCBI Official Full Name
Myosin IC
NCBI Official Synonym Full Names
myosin IC
NCBI Official Symbol
MYO1C
NCBI Official Synonym Symbols
NMI; MMIb; myr2; MMI-beta
NCBI Protein Information
unconventional myosin-Ic
UniProt Protein Name
Unconventional myosin-Ic
Protein Family
UniProt Gene Name
MYO1C
UniProt Synonym Gene Names
MMI-beta; MMIb
UniProt Entry Name
MYO1C_HUMAN

NCBI Description

This gene encodes a member of the unconventional myosin protein family, which are actin-based molecular motors. The protein is found in the cytoplasm, and one isoform with a unique N-terminus is also found in the nucleus. The nuclear isoform associates with RNA polymerase I and II and functions in transcription initiation. The mouse ortholog of this protein also functions in intracellular vesicle transport to the plasma membrane. Multiple transcript variants encoding different isoforms have been found for this gene. The related gene myosin IE has been referred to as myosin IC in the literature, but it is a distinct locus on chromosome 19. [provided by RefSeq, Jul 2008]

Uniprot Description

MYO1C: Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. Their highly divergent tails are presumed to bind to membranous compartments, which would be moved relative to actin filaments. Involved in glucose transporter recycling in response to insulin by regulating movement of intracellular GLUT4-containing vesicles to the plasma membrane. Component of the hair cell's (the sensory cells of the inner ear) adaptation-motor complex. Acts as a mediator of adaptation of mechanoelectrical transduction in stereocilia of vestibular hair cells. Binds phosphoinositides and links the actin cytoskeleton to cellular membranes. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Actin-binding; Motility/polarity/chemotaxis; Contractile; Motor; Lipid-binding; Nucleolus

Chromosomal Location of Human Ortholog: 17p13.3

Cellular Component: myosin I complex; microvillus; mitochondrion; cytoplasmic membrane-bound vesicle; nuclear pore; cytosol; lipid raft; nucleoplasm; filamentous actin; ruffle; membrane; cytoplasm; unconventional myosin complex; plasma membrane; basal plasma membrane; nucleolus; stress fiber; lateral plasma membrane; brush border

Molecular Function: protein C-terminus binding; calmodulin binding; protein binding; motor activity; Ral GTPase binding; actin binding; actin-dependent ATPase activity; ATP binding; receptor binding

Biological Process: mRNA transport; metabolic process; innate immune response; protein targeting to membrane; protein targeting; positive regulation of cell migration

Research Articles on MYO1C

Similar Products

Product Notes

The MYO1C myo1c (Catalog #AAA5300641) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Myosin Ic antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Myosin Ic can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the MYO1C myo1c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Myosin Ic, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.