Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TSR2Sample Tissue: Human MCF7 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human TSR2 Polyclonal Antibody | anti-TSR2 antibody

TSR2 Antibody - middle region

Gene Names
TSR2; WGG1; DBA14; DT1P1A10
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
TSR2; Polyclonal Antibody; TSR2 Antibody - middle region; anti-TSR2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RNADLELDEVEDFLGELLTNEFDTVVEDGSLPQVSQQLQTMFHHFQRGDG
Sequence Length
191
Applicable Applications for anti-TSR2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TSR2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TSR2Sample Tissue: Human MCF7 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TSR2Sample Tissue: Human MCF7 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-TSR2 antibody
May be involved in 20S pre-rRNA processing.
Product Categories/Family for anti-TSR2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21 kDa
NCBI Official Full Name
pre-rRNA-processing protein TSR2 homolog isoform a
NCBI Official Synonym Full Names
TSR2 ribosome maturation factor
NCBI Official Symbol
TSR2
NCBI Official Synonym Symbols
WGG1; DBA14; DT1P1A10
NCBI Protein Information
pre-rRNA-processing protein TSR2 homolog
UniProt Protein Name
Pre-rRNA-processing protein TSR2 homolog
UniProt Gene Name
TSR2
UniProt Entry Name
TSR2_HUMAN

NCBI Description

The protein encoded by this gene appears to repress the transcription of NF-kappaB and may be involved in apoptosis. Defects in this gene are a cause of Diamond-Blackfan anemia. [provided by RefSeq, Oct 2016]

Uniprot Description

TSR2: May be involved in 20S pre-rRNA processing (Potential). Belongs to the TSR2 family.

Chromosomal Location of Human Ortholog: Xp11.22

Cellular Component: nucleus

Molecular Function: protein binding

Biological Process: maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)

Disease: Diamond-blackfan Anemia 14 With Mandibulofacial Dysostosis

Research Articles on TSR2

Similar Products

Product Notes

The TSR2 tsr2 (Catalog #AAA3221056) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TSR2 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TSR2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TSR2 tsr2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RNADLELDEV EDFLGELLTN EFDTVVEDGS LPQVSQQLQT MFHHFQRGDG. It is sometimes possible for the material contained within the vial of "TSR2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.