Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen using 246074 (37.73KD))

Mouse FGF1 Monoclonal Antibody | anti-FGF1 antibody

FGF1 (Fibroblast Growth Factor 1 (Acidic), AFGF, ECGF, ECGF-beta, ECGFA, ECGFB, FGF-alpha, FGFA, GLIO703, HBGF1) (MaxLight 650)

Gene Names
FGF1; AFGF; ECGF; FGFA; ECGFA; ECGFB; FGF-1; HBGF1; HBGF-1; GLIO703; ECGF-beta; FGF-alpha
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
FGF1; Monoclonal Antibody; FGF1 (Fibroblast Growth Factor 1 (Acidic); AFGF; ECGF; ECGF-beta; ECGFA; ECGFB; FGF-alpha; FGFA; GLIO703; HBGF1) (MaxLight 650); Fibroblast Growth Factor 1 (Acidic); HBGF1; anti-FGF1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3F5
Specificity
Recognizes human FGF1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Sequence Length
155
Applicable Applications for anti-FGF1 antibody
mmunofluorescence (IF), Western Blot (WB), In situ Proximity Ligation Assay (Cell)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa46-155 from human FGF1 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen using 246074 (37.73KD))

Western Blot (WB) (Western Blot detection against Immunogen using 246074 (37.73KD))

Immunofluorescence (IF)

(Immunofluorescence of 246074 (10 ug/ml) on HeLa cell.)

Immunofluorescence (IF) (Immunofluorescence of 246074 (10 ug/ml) on HeLa cell.)

Testing Data

(Proximity Ligation Analysis of protein-protein interactions between FGFR2 and FGF1. HeLa cells were stained with anti-FGFR2 rabbit purified polyclonal 1:1200 and 246074 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

Testing Data (Proximity Ligation Analysis of protein-protein interactions between FGFR2 and FGF1. HeLa cells were stained with anti-FGFR2 rabbit purified polyclonal 1:1200 and 246074 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)
Related Product Information for anti-FGF1 antibody
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Multiple alternatively spliced variants encoding different isoforms have been described. [provided by RefSeq]
Product Categories/Family for anti-FGF1 antibody
References
1. Acidic Fibroblast Growth Factor (FGF) Potentiates Glial-mediated Neurotoxicity by Activating FGFR2 IIIb Protein. Lee M, Kang Y, Suk K, Schwab C, Yu S, McGeer PL.J Biol Chem. 2011 Dec 2;286(48):41230-45. Epub 2011 Oct 11.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
FGF1 protein
NCBI Official Synonym Full Names
fibroblast growth factor 1
NCBI Official Symbol
FGF1
NCBI Official Synonym Symbols
AFGF; ECGF; FGFA; ECGFA; ECGFB; FGF-1; HBGF1; HBGF-1; GLIO703; ECGF-beta; FGF-alpha
NCBI Protein Information
fibroblast growth factor 1
Protein Family

NCBI Description

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Multiple alternatively spliced variants encoding different isoforms have been described. [provided by RefSeq, Jan 2009]

Research Articles on FGF1

Similar Products

Product Notes

The FGF1 (Catalog #AAA6227509) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's FGF1 can be used in a range of immunoassay formats including, but not limited to, mmunofluorescence (IF), Western Blot (WB), In situ Proximity Ligation Assay (Cell). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FGF1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FGF1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.